Oryx dammah (scimitar-horned oryx): 120874170 Help Entry 120874170         CDS       T07255                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04010   MAPK signaling pathway oda04014   Ras signaling pathway oda04015   Rap1 signaling pathway oda04022   cGMP-PKG signaling pathway oda04066   HIF-1 signaling pathway oda04068   FoxO signaling pathway oda04072   Phospholipase D signaling pathway oda04081   Hormone signaling oda04114   Oocyte meiosis oda04140   Autophagy - animal oda04150   mTOR signaling pathway oda04151   PI3K-Akt signaling pathway oda04152   AMPK signaling pathway oda04211   Longevity regulating pathway oda04213   Longevity regulating pathway - multiple species oda04810   Regulation of actin cytoskeleton oda04910   Insulin signaling pathway oda04911   Insulin secretion oda04913   Ovarian steroidogenesis oda04914   Progesterone-mediated oocyte maturation oda04917   Prolactin signaling pathway oda04923   Regulation of lipolysis in adipocytes oda04930   Type II diabetes mellitus oda04931   Insulin resistance oda04932   Non-alcoholic fatty liver disease oda04940   Type I diabetes mellitus oda04950   Maturity onset diabetes of the young oda04960   Aldosterone-regulated sodium reabsorption oda05010   Alzheimer disease oda05215   Prostate cancer oda05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120874170 (INS)    04014 Ras signaling pathway     120874170 (INS)    04015 Rap1 signaling pathway     120874170 (INS)    04066 HIF-1 signaling pathway     120874170 (INS)    04068 FoxO signaling pathway     120874170 (INS)    04072 Phospholipase D signaling pathway     120874170 (INS)    04022 cGMP-PKG signaling pathway     120874170 (INS)    04151 PI3K-Akt signaling pathway     120874170 (INS)    04152 AMPK signaling pathway     120874170 (INS)    04150 mTOR signaling pathway     120874170 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     120874170 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120874170 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     120874170 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120874170 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     120874170 (INS)    04910 Insulin signaling pathway     120874170 (INS)    04923 Regulation of lipolysis in adipocytes     120874170 (INS)    04913 Ovarian steroidogenesis     120874170 (INS)    04914 Progesterone-mediated oocyte maturation     120874170 (INS)    04917 Prolactin signaling pathway     120874170 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     120874170 (INS)   09149 Aging    04211 Longevity regulating pathway     120874170 (INS)    04213 Longevity regulating pathway - multiple species     120874170 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     120874170 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     120874170 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     120874170 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     120874170 (INS)    04940 Type I diabetes mellitus     120874170 (INS)    04950 Maturity onset diabetes of the young     120874170 (INS)    04932 Non-alcoholic fatty liver disease     120874170 (INS)    04931 Insulin resistance     120874170 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120874170 (INS) Cytokines and neuropeptides [BR:oda04052]  Neuropeptides   Unclassified    120874170 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  120874170 NCBI-ProteinID:  XP_040111257 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MALWTHLVPVLALLALWAPAPTRSFVNQHLCGSHLVEALYLVCGERGFFYTPKARREMES PQVGALELAGGPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcacctggtgcccgtgctggccctgctggcgctctgggcccccgcc cccacccgctccttcgtcaaccagcacctgtgcgggtcccacctggtggaggcgctgtac ctggtgtgcggagaacgcggcttcttctacacgcccaaggcccgccgggagatggagagc ccccaggtgggggcgctggagctggccggaggccctggcgcgggcggcctggaggggccc ccgcagaagcgtggcatcgtggagcagtgctgtgccggcgtctgctcgctctaccagctg gagaactactgtaactag

DBGET integrated database retrieval system