Oryx dammah (scimitar-horned oryx): 120874699 Help Entry 120874699         CDS       T07255                                  Symbol CFL1 Name (RefSeq) LOW QUALITY PROTEIN: cofilin-1   KO K05765   cofilin Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04360   Axon guidance oda04666   Fc gamma R-mediated phagocytosis oda04810   Regulation of actin cytoskeleton oda05133   Pertussis oda05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:oda00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120874699 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     120874699 (CFL1)   09158 Development and regeneration    04360 Axon guidance     120874699 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120874699 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     120874699 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oda04131]     120874699 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oda04812]     120874699 (CFL1)    04147 Exosome [BR:oda04147]     120874699 (CFL1) Membrane trafficking [BR:oda04131]  Others   Actin-binding proteins    Others     120874699 (CFL1) Cytoskeleton proteins [BR:oda04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      120874699 (CFL1) Exosome [BR:oda04147]  Exosomal proteins   Proteins found in most exosomes    120874699 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  120874699 NCBI-ProteinID:  XP_040112255 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctccggtgtggctgtctctgatggggtcatcaaagtgttcaacgacatgaaagtg cgtaagtcgtcaacaccagaggaagtgaagaagcgcaagaaggcggtgctcttctgcctg agtgaggacaagaagaacatcatcctggaggagggcaaggagatcttggtgggtgacgtg ggccagacggtagacgacccctatgccacctttgtcaagatgctgccagacaaagactgc cgctatgccctctatgatgcaacctacgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagtgtgcaccccttaagagcaaaatgatctatgccagctcc aaggatgccatcaagaagaagctgacagggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgttgcacccttgcagagaagctggggggcagcgctgtcatctcc ttggagggcaagcctttgtga

DBGET integrated database retrieval system