KEGG   Oryx dammah (scimitar-horned oryx): 120876943
Entry
120876943         CDS       T07255                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
oda  Oryx dammah (scimitar-horned oryx)
Pathway
oda01521  EGFR tyrosine kinase inhibitor resistance
oda01522  Endocrine resistance
oda01524  Platinum drug resistance
oda04010  MAPK signaling pathway
oda04012  ErbB signaling pathway
oda04014  Ras signaling pathway
oda04015  Rap1 signaling pathway
oda04022  cGMP-PKG signaling pathway
oda04024  cAMP signaling pathway
oda04062  Chemokine signaling pathway
oda04066  HIF-1 signaling pathway
oda04068  FoxO signaling pathway
oda04071  Sphingolipid signaling pathway
oda04072  Phospholipase D signaling pathway
oda04114  Oocyte meiosis
oda04140  Autophagy - animal
oda04148  Efferocytosis
oda04150  mTOR signaling pathway
oda04151  PI3K-Akt signaling pathway
oda04210  Apoptosis
oda04218  Cellular senescence
oda04261  Adrenergic signaling in cardiomyocytes
oda04270  Vascular smooth muscle contraction
oda04350  TGF-beta signaling pathway
oda04360  Axon guidance
oda04370  VEGF signaling pathway
oda04371  Apelin signaling pathway
oda04380  Osteoclast differentiation
oda04510  Focal adhesion
oda04517  IgSF CAM signaling
oda04520  Adherens junction
oda04540  Gap junction
oda04550  Signaling pathways regulating pluripotency of stem cells
oda04611  Platelet activation
oda04613  Neutrophil extracellular trap formation
oda04620  Toll-like receptor signaling pathway
oda04621  NOD-like receptor signaling pathway
oda04625  C-type lectin receptor signaling pathway
oda04650  Natural killer cell mediated cytotoxicity
oda04657  IL-17 signaling pathway
oda04658  Th1 and Th2 cell differentiation
oda04659  Th17 cell differentiation
oda04660  T cell receptor signaling pathway
oda04662  B cell receptor signaling pathway
oda04664  Fc epsilon RI signaling pathway
oda04666  Fc gamma R-mediated phagocytosis
oda04668  TNF signaling pathway
oda04713  Circadian entrainment
oda04720  Long-term potentiation
oda04722  Neurotrophin signaling pathway
oda04723  Retrograde endocannabinoid signaling
oda04724  Glutamatergic synapse
oda04725  Cholinergic synapse
oda04726  Serotonergic synapse
oda04730  Long-term depression
oda04810  Regulation of actin cytoskeleton
oda04910  Insulin signaling pathway
oda04912  GnRH signaling pathway
oda04914  Progesterone-mediated oocyte maturation
oda04915  Estrogen signaling pathway
oda04916  Melanogenesis
oda04917  Prolactin signaling pathway
oda04919  Thyroid hormone signaling pathway
oda04921  Oxytocin signaling pathway
oda04926  Relaxin signaling pathway
oda04928  Parathyroid hormone synthesis, secretion and action
oda04929  GnRH secretion
oda04930  Type II diabetes mellitus
oda04933  AGE-RAGE signaling pathway in diabetic complications
oda04934  Cushing syndrome
oda04935  Growth hormone synthesis, secretion and action
oda04960  Aldosterone-regulated sodium reabsorption
oda05010  Alzheimer disease
oda05020  Prion disease
oda05022  Pathways of neurodegeneration - multiple diseases
oda05034  Alcoholism
oda05132  Salmonella infection
oda05133  Pertussis
oda05135  Yersinia infection
oda05140  Leishmaniasis
oda05142  Chagas disease
oda05145  Toxoplasmosis
oda05152  Tuberculosis
oda05160  Hepatitis C
oda05161  Hepatitis B
oda05163  Human cytomegalovirus infection
oda05164  Influenza A
oda05165  Human papillomavirus infection
oda05166  Human T-cell leukemia virus 1 infection
oda05167  Kaposi sarcoma-associated herpesvirus infection
oda05170  Human immunodeficiency virus 1 infection
oda05171  Coronavirus disease - COVID-19
oda05200  Pathways in cancer
oda05203  Viral carcinogenesis
oda05205  Proteoglycans in cancer
oda05206  MicroRNAs in cancer
oda05207  Chemical carcinogenesis - receptor activation
oda05208  Chemical carcinogenesis - reactive oxygen species
oda05210  Colorectal cancer
oda05211  Renal cell carcinoma
oda05212  Pancreatic cancer
oda05213  Endometrial cancer
oda05214  Glioma
oda05215  Prostate cancer
oda05216  Thyroid cancer
oda05218  Melanoma
oda05219  Bladder cancer
oda05220  Chronic myeloid leukemia
oda05221  Acute myeloid leukemia
oda05223  Non-small cell lung cancer
oda05224  Breast cancer
oda05225  Hepatocellular carcinoma
oda05226  Gastric cancer
oda05230  Central carbon metabolism in cancer
oda05231  Choline metabolism in cancer
oda05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oda05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oda00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    120876943 (MAPK3)
   04012 ErbB signaling pathway
    120876943 (MAPK3)
   04014 Ras signaling pathway
    120876943 (MAPK3)
   04015 Rap1 signaling pathway
    120876943 (MAPK3)
   04350 TGF-beta signaling pathway
    120876943 (MAPK3)
   04370 VEGF signaling pathway
    120876943 (MAPK3)
   04371 Apelin signaling pathway
    120876943 (MAPK3)
   04668 TNF signaling pathway
    120876943 (MAPK3)
   04066 HIF-1 signaling pathway
    120876943 (MAPK3)
   04068 FoxO signaling pathway
    120876943 (MAPK3)
   04072 Phospholipase D signaling pathway
    120876943 (MAPK3)
   04071 Sphingolipid signaling pathway
    120876943 (MAPK3)
   04024 cAMP signaling pathway
    120876943 (MAPK3)
   04022 cGMP-PKG signaling pathway
    120876943 (MAPK3)
   04151 PI3K-Akt signaling pathway
    120876943 (MAPK3)
   04150 mTOR signaling pathway
    120876943 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    120876943 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    120876943 (MAPK3)
   04148 Efferocytosis
    120876943 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    120876943 (MAPK3)
   04210 Apoptosis
    120876943 (MAPK3)
   04218 Cellular senescence
    120876943 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    120876943 (MAPK3)
   04520 Adherens junction
    120876943 (MAPK3)
   04540 Gap junction
    120876943 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    120876943 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    120876943 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    120876943 (MAPK3)
   04613 Neutrophil extracellular trap formation
    120876943 (MAPK3)
   04620 Toll-like receptor signaling pathway
    120876943 (MAPK3)
   04621 NOD-like receptor signaling pathway
    120876943 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    120876943 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    120876943 (MAPK3)
   04660 T cell receptor signaling pathway
    120876943 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    120876943 (MAPK3)
   04659 Th17 cell differentiation
    120876943 (MAPK3)
   04657 IL-17 signaling pathway
    120876943 (MAPK3)
   04662 B cell receptor signaling pathway
    120876943 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    120876943 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    120876943 (MAPK3)
   04062 Chemokine signaling pathway
    120876943 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    120876943 (MAPK3)
   04929 GnRH secretion
    120876943 (MAPK3)
   04912 GnRH signaling pathway
    120876943 (MAPK3)
   04915 Estrogen signaling pathway
    120876943 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    120876943 (MAPK3)
   04917 Prolactin signaling pathway
    120876943 (MAPK3)
   04921 Oxytocin signaling pathway
    120876943 (MAPK3)
   04926 Relaxin signaling pathway
    120876943 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    120876943 (MAPK3)
   04919 Thyroid hormone signaling pathway
    120876943 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    120876943 (MAPK3)
   04916 Melanogenesis
    120876943 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    120876943 (MAPK3)
   04270 Vascular smooth muscle contraction
    120876943 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    120876943 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    120876943 (MAPK3)
   04725 Cholinergic synapse
    120876943 (MAPK3)
   04726 Serotonergic synapse
    120876943 (MAPK3)
   04720 Long-term potentiation
    120876943 (MAPK3)
   04730 Long-term depression
    120876943 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    120876943 (MAPK3)
   04722 Neurotrophin signaling pathway
    120876943 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    120876943 (MAPK3)
   04380 Osteoclast differentiation
    120876943 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    120876943 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    120876943 (MAPK3)
   05206 MicroRNAs in cancer
    120876943 (MAPK3)
   05205 Proteoglycans in cancer
    120876943 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    120876943 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    120876943 (MAPK3)
   05203 Viral carcinogenesis
    120876943 (MAPK3)
   05230 Central carbon metabolism in cancer
    120876943 (MAPK3)
   05231 Choline metabolism in cancer
    120876943 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    120876943 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    120876943 (MAPK3)
   05212 Pancreatic cancer
    120876943 (MAPK3)
   05225 Hepatocellular carcinoma
    120876943 (MAPK3)
   05226 Gastric cancer
    120876943 (MAPK3)
   05214 Glioma
    120876943 (MAPK3)
   05216 Thyroid cancer
    120876943 (MAPK3)
   05221 Acute myeloid leukemia
    120876943 (MAPK3)
   05220 Chronic myeloid leukemia
    120876943 (MAPK3)
   05218 Melanoma
    120876943 (MAPK3)
   05211 Renal cell carcinoma
    120876943 (MAPK3)
   05219 Bladder cancer
    120876943 (MAPK3)
   05215 Prostate cancer
    120876943 (MAPK3)
   05213 Endometrial cancer
    120876943 (MAPK3)
   05224 Breast cancer
    120876943 (MAPK3)
   05223 Non-small cell lung cancer
    120876943 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    120876943 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    120876943 (MAPK3)
   05161 Hepatitis B
    120876943 (MAPK3)
   05160 Hepatitis C
    120876943 (MAPK3)
   05171 Coronavirus disease - COVID-19
    120876943 (MAPK3)
   05164 Influenza A
    120876943 (MAPK3)
   05163 Human cytomegalovirus infection
    120876943 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    120876943 (MAPK3)
   05165 Human papillomavirus infection
    120876943 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    120876943 (MAPK3)
   05135 Yersinia infection
    120876943 (MAPK3)
   05133 Pertussis
    120876943 (MAPK3)
   05152 Tuberculosis
    120876943 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    120876943 (MAPK3)
   05140 Leishmaniasis
    120876943 (MAPK3)
   05142 Chagas disease
    120876943 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    120876943 (MAPK3)
   05020 Prion disease
    120876943 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    120876943 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    120876943 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    120876943 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    120876943 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    120876943 (MAPK3)
   04934 Cushing syndrome
    120876943 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    120876943 (MAPK3)
   01524 Platinum drug resistance
    120876943 (MAPK3)
   01522 Endocrine resistance
    120876943 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oda01001]
    120876943 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oda03036]
    120876943 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oda04147]
    120876943 (MAPK3)
Enzymes [BR:oda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     120876943 (MAPK3)
Protein kinases [BR:oda01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   120876943 (MAPK3)
Chromosome and associated proteins [BR:oda03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     120876943 (MAPK3)
Exosome [BR:oda04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   120876943 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 120876943
NCBI-ProteinID: XP_040115085
LinkDB
Position
Unknown
AA seq 380 aa
MAAAAAAQGGGGGEPRGTDGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGVLEAS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggaactgatggg
gtcggcccgggggtcccgggggaggtggagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcagct
tatgaccacgtgcgcaagactcgagtggccatcaagaagatcagcccctttgagcatcag
acctactgccagcgcacgttgcgagagattcagattctgctgcgcttccgccatgagaac
gtcattggcatccgagacattctgcgagcacccaccctggaagccatgagggatgtctac
atcgtgcaggacctgatggagacagacctgtacaaattgctcaaaagccagcagctgagc
aacgaccacgtatgctacttcctgtaccagatcctgcggggcctgaagtatatccactcc
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgatttcggtcttgcccggattgctgatcccgagcatgaccacactggc
ttcttgacggaatacgtggccacacgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccccggcaagcactacctggaccagctcaaccacattctgggt
attctgggctccccatcccaggaggacctgaactgtatcatcaacatgaaagcccgaaac
tacctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcctaagtcg
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaagaagcgctggctcacccctacctggagcagtactatgacccaacggatgag
ccagtggccgaggaacctttcaccttcgacatggagctggatgatctacccaaggaacga
ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaggcctcc
taa

DBGET integrated database retrieval system