Oryx dammah (scimitar-horned oryx): 120877946 Help Entry 120877946         CDS       T07255                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04072   Phospholipase D signaling pathway oda04140   Autophagy - animal oda04150   mTOR signaling pathway oda04151   PI3K-Akt signaling pathway oda04152   AMPK signaling pathway oda04211   Longevity regulating pathway oda04218   Cellular senescence oda04714   Thermogenesis oda04910   Insulin signaling pathway oda04919   Thyroid hormone signaling pathway oda05163   Human cytomegalovirus infection oda05165   Human papillomavirus infection oda05168   Herpes simplex virus 1 infection oda05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     120877946 (RHEB)    04151 PI3K-Akt signaling pathway     120877946 (RHEB)    04152 AMPK signaling pathway     120877946 (RHEB)    04150 mTOR signaling pathway     120877946 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120877946 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     120877946 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     120877946 (RHEB)    04919 Thyroid hormone signaling pathway     120877946 (RHEB)   09149 Aging    04211 Longevity regulating pathway     120877946 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     120877946 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     120877946 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     120877946 (RHEB)    05163 Human cytomegalovirus infection     120877946 (RHEB)    05165 Human papillomavirus infection     120877946 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oda04031]     120877946 (RHEB) GTP-binding proteins [BR:oda04031]  Small (monomeric) G-proteins   Ras Family    Rheb     120877946 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  120877946 NCBI-ProteinID:  XP_040116367 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgttgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccatagaa aatactttcacaaaattgatcacagtaaatggacaggagtatcatcttcaacttgtggac acagctgggcaggatgagtattccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgatcaaagttatccat ggcaaattattggatatggtggggaaagtacaaatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaagcgttagcagagtct tggaacgcagcatttttggaatcgtctgcaaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc tgctcggtgatgtga

DBGET integrated database retrieval system