Oryx dammah (scimitar-horned oryx): 120878495 Help Entry 120878495         CDS       T07255                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04613   Neutrophil extracellular trap formation oda05034   Alcoholism oda05202   Transcriptional misregulation in cancer oda05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oda00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120878495  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     120878495   09163 Immune disease    05322 Systemic lupus erythematosus     120878495   09165 Substance dependence    05034 Alcoholism     120878495  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oda03036]     120878495   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120878495 Chromosome and associated proteins [BR:oda03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120878495 Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120878495 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  120878495 NCBI-ProteinID:  XP_040117018 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MDRTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEVSEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGECA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggatcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcgccgaggaagcaa ctcgctacaaaagccgctcgcaagagtgcgccctctactggaggggtaaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaatcagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggtaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccacgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaatgtgcttaa

DBGET integrated database retrieval system