Oryx dammah (scimitar-horned oryx): 120882339 Help Entry 120882339         CDS       T07255                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04814   Motor proteins oda05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oda00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     120882339 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120882339 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oda03037]     120882339 (DYNLT3)    04812 Cytoskeleton proteins [BR:oda04812]     120882339 (DYNLT3) Cilium and associated proteins [BR:oda03037]  Motile cilia and associated proteins   Dynein arm    120882339 (DYNLT3) Cytoskeleton proteins [BR:oda04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      120882339 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  120882339 NCBI-ProteinID:  XP_040122253 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRPCDEVGFNADEAHNIVKECIDGVLGGEDYNQNNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSPYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgcccctgcgacgaggttggtttcaatgctgatgaagcccacaat attgttaaagagtgtatagatggggtcttgggaggtgaagattataatcagaacaatatc aaccagtggactgcaagcatagtggaacaatccctagcacatctggttaagctgggaaaa gcttataagtatattgtgacctgtgcagtggtccagaggagtccatatggctttcacaca gccagctcatgtttttgggacaccacatctgatggaacctgcactgtaagatgggagaac cgaaccatgaactgtattgtcaacgtttttgccattgctattgtcctgtag

DBGET integrated database retrieval system