Oryx dammah (scimitar-horned oryx): 120883148 Help Entry 120883148         CDS       T07255                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda03410   Base excision repair oda04140   Autophagy - animal oda04217   Necroptosis oda04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:oda00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     120883148 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120883148 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     120883148 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     120883148 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oda03036]     120883148 (HMGB1)    03400 DNA repair and recombination proteins [BR:oda03400]     120883148 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120883148 (HMGB1) Chromosome and associated proteins [BR:oda03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     120883148 (HMGB1) DNA repair and recombination proteins [BR:oda03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      120883148 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      120883148 (HMGB1) Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120883148 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 NOA36 Nop14 Motif Other DBs NCBI-GeneID:  120883148 NCBI-ProteinID:  XP_040123080 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDALVNFSEFSKKCSERWKTMSAKEKGKF KDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGVMWNNTAADDKQPYEKKAAKVKEKYEKDIAAYQAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccggatgctttagtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt aaagacatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacttatatccct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg gcctttttcttgttttgttctgagtatcgtccaaaaatcaaaggcgaacatcctggcctg tccattggtgatgttgcaaagaaactgggagtgatgtggaataacactgctgcggatgac aagcagccttatgagaagaaggctgctaaggtgaaggaaaaatatgaaaaggatattgct gcataccaagctaaagggaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggaa gaagatgaagaggatgaggaggaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system