Oryx dammah (scimitar-horned oryx): 120883518 Help Entry 120883518         CDS       T07255                                  Symbol MTLN Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism oda  Oryx dammah (scimitar-horned oryx) Brite KEGG Orthology (KO) [BR:oda00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:oda03029]     120883518 (MTLN) Mitochondrial biogenesis [BR:oda03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     120883518 (MTLN) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom CheW_CheR_link Motif Other DBs NCBI-GeneID:  120883518 NCBI-ProteinID:  XP_040123481 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MADVSERTLQLSVLVAFASGVLVGWQANRLRRRYLDWRKKRLQDKLAATQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcggacgtgtccgagaggacgctgcagttgtctgtactggtggctttcgcctccgga gtgctcgtgggctggcaggcaaaccggctgcggcggcgctacctggactggaggaagaag aggctgcaagacaagctagcggcgacgcagaagaagctggatctggcctga

DBGET integrated database retrieval system