KEGG   Orrella dioscoreae: ODI_R2806
Entry
ODI_R2806         CDS       T05133                                 
Name
(GenBank) L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:7.6.2.9]
Organism
odi  Orrella dioscoreae
Pathway
odi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:odi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ODI_R2806
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:odi02000]
    ODI_R2806
Enzymes [BR:odi01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     ODI_R2806
Transporters [BR:odi02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    ODI_R2806
SSDB
Motif
Pfam: ABC_tran CBS AAA_21 AAA_22 ABC_ATPase AAA_16 AAA_29 ATPase_2 RsgA_GTPase Viral_helicase1 SbcC_Walker_B AAA_33 AAA_14 AAA_18 AAA_15
Other DBs
NCBI-ProteinID: SOE50568
UniProt: A0A1C3JZY1
LinkDB
Position
I:complement(3052063..3053334)
AA seq 423 aa
MSKIEVKNIYKIFGAHPKKWLEAAQQGISKDELLARSGHTLGLRDISLSIDEGSIYVIMG
LSGSGKSTLIRHFNRLIEPSAGQILVDGVDVVTLGKRELEAFRQRKMSMVFQRFGLMPHR
TVLENAAYGLAIQGVGKEEREQRARQWLEQVGLSGFEKQYPHQLSGGMQQRVGLARALAT
DAEILLMDEAFSALDPLIRREMQDHLLQLQAKLNKTIVFITHDLDEALRLGNRIAILKDG
ELVQEGTPEDILLNPANDYVQAFLQDVNRGKVLNATHAVNPPRLTLTMRSRPAHALERMQ
ALRYEYAPVLDGKRLAGMLTVDAARQAAGSGDRDVSGYIDEISSVPAATGLDEILARLLH
SDQPLAVTGENDEFIGMLSRRKVVELVTPPAIEPSADSAAGQSGPAAAEPASVEFAEPPA
KAS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagcaagatcgaagtcaagaacatctacaagatcttcggcgcgcacccgaagaagtgg
ctggaagccgcccagcagggcatcagcaaggacgagctgctggcgcgcagcggccacacg
ctgggcctgcgcgacatcagcctgtccatcgacgaaggcagcatctacgtcatcatgggc
ctgtcgggctcgggcaagtcgacgctgatccgccatttcaaccgcctcatcgagccgagc
gccggccagatcctggtcgacggcgtcgatgtcgtcacgctgggcaagcgcgagctggag
gctttccgccaacgcaagatgagcatggtgttccagcgctttggcctgatgccgcaccgc
acggtgctggagaacgcggcctatggcctggcgatccagggcgtgggcaaggaggagcgc
gagcagcgcgcgcgccagtggctggagcaggtggggctgtcggggttcgagaagcagtat
ccgcatcagttgtccggcggcatgcagcagcgcgtgggcctggcccgggcactggccacc
gatgccgagatcctgctgatggatgaagccttctcggcgctggatccgttgatccgccgc
gagatgcaggatcacctgctgcagttgcaggccaagctgaacaagaccatcgtcttcatc
acgcatgacctggacgaggccttgcgcctgggcaaccgcatcgccatcctgaaggacggc
gaactggtgcaggagggcacgcccgaggacatcctgctgaatccggccaatgactatgtc
caggccttcctgcaggacgtgaaccggggcaaggtgctgaacgcgacgcacgccgtcaat
ccgccccggctgacgctgaccatgcgttcgcgtccggcgcacgcgctggagcgcatgcag
gccctgcgctacgaatacgcgccggtgctggatggcaagcgcctggccggcatgctgacc
gtggatgccgcccgccaggcggcgggcagcggcgatcgggacgtgtcgggctacatcgac
gagatttcgtcggtgcccgccgccacggggctcgatgaaatcctggcgcgcctgctgcac
agcgaccagccgctggcggtgacgggcgagaacgacgagttcatcggcatgctgtcgcgc
cgcaaggtggtggagctggtgacgccgccggcgatcgagccctcggcggacagtgcggcg
ggccagagtggtccggccgccgccgaacctgcaagcgtcgaattcgcagagccgccggca
aaggcgtcgtga

DBGET integrated database retrieval system