Ostrea edulis (European flat oyster): 125647607 Help Entry 125647607         CDS       T09123                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism oed  Ostrea edulis (European flat oyster) Pathway oed04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:oed00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     125647607  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oed04121]     125647607    03400 DNA repair and recombination proteins [BR:oed03400]     125647607 Ubiquitin system [BR:oed04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      125647607    Cul5 complex      125647607 DNA repair and recombination proteins [BR:oed03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      125647607 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  125647607 NCBI-ProteinID:  XP_048730323 LinkDB All DBs Position 1:64335385..64351669 Genome browser AA seq 120 aa AA seqDB search MDVFLMIRRKKATIFTDAKESTAVSDVKKIVEGILKIRPEDQKLFKDDQPLDDNKTLGDY GFTFATARAQAPATIGLACKQDDGEFEQLEITPLSSPPELPDVMKQQDSTSAHAQEQTAS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttgatgattagaaggaaaaaggctaccatctttacagatgcaaaggag tccaccgcagttagtgatgtaaaaaaaattgttgaaggtattctaaagatccgacctgaa gatcaaaagctgttcaaagatgatcagccactagatgacaacaaaacactaggagattat ggttttacttttgccacagcaagagcacaggccccagcaacaattggactggcttgtaaa caagatgatggcgagtttgaacagttagagatcaccccactctctagtcccccagaacta ccggatgtgatgaagcaacaggactccacatcagcacatgcacaagaacaaacagcatct taa

DBGET integrated database retrieval system