Ostrea edulis (European flat oyster): 125651780 Help Entry 125651780         CDS       T09123                                  Name (RefSeq) rho-related protein racL-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism oed  Ostrea edulis (European flat oyster) Pathway oed04145   Phagosome oed04148   Efferocytosis oed04310   Wnt signaling pathway oed04620   Toll-like receptor signaling pathway oed05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:oed00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     125651780  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     125651780    04148 Efferocytosis     125651780  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125651780  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     125651780  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oed04131]     125651780   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oed04147]     125651780    04031 GTP-binding proteins [BR:oed04031]     125651780 Membrane trafficking [BR:oed04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     125651780  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     125651780   Macropinocytosis    Ras GTPases     125651780  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     125651780 Exosome [BR:oed04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125651780   Exosomal proteins of other body fluids (saliva and urine)    125651780   Exosomal proteins of colorectal cancer cells    125651780   Exosomal proteins of bladder cancer cells    125651780 GTP-binding proteins [BR:oed04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     125651780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 LpoB Motif Other DBs NCBI-GeneID:  125651780 NCBI-ProteinID:  XP_048736493 LinkDB All DBs Position 5:71849212..71850244 Genome browser AA seq 202 aa AA seqDB search MVVSGEMTCIQCTIVGDKKVGKSTISRGLCETEGVLDIHNNNYQSTIFDNIAGTTNVEGK DVPISLFDCSSETEHSAIREFAYKDSNVFILCYSVVDRTSLVNIRDKWIPEIRKFLGKKF KLLVVGTQTDIRDSVCLDQDPPINKTEGADFARQIGADYFMECSSTSPSTFCDIFKHVAM IGKKTKRRRSPVNLVRRLLGTN NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggtcgtgtctggagagatgacttgtatacagtgcacgatagtgggagacaagaaggtg gggaagtccacaatcagtagaggtctgtgtgagactgagggggttctggacatacacaat aacaactaccagtctacaatctttgacaatattgccggaactaccaatgttgaaggaaaa gatgtacctattagcttatttgactgttcaagtgagacggaacattctgcaatcagagaa tttgcttacaaggacagcaatgtgttcattctgtgttacagtgtggtagacaggacttct ttagtgaacatcagggacaaatggattccagaaatccgaaaatttcttggcaaaaaattt aaactgttggtggtagggacacagacagacatacgtgattccgtgtgtctggaccaggac ccgccaatcaataaaaccgaaggtgctgactttgcgcgccaaattggtgcggactatttc atggagtgtagctccacatctccgtccactttttgtgacattttcaaacatgtggccatg atcggcaaaaagacaaaacgaaggcgatctcctgtaaatctagttcgaagactgctgggt acaaattag

DBGET integrated database retrieval system