Ostrea edulis (European flat oyster): 125652760 Help Entry 125652760         CDS       T09123                                  Name (RefSeq) cdc42 homolog   KO K04393   cell division control protein 42 Organism oed  Ostrea edulis (European flat oyster) Pathway oed04144   Endocytosis oed04517   IgSF CAM signaling oed04518   Integrin signaling oed04519   Cadherin signaling oed05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:oed00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     125652760    04518 Integrin signaling     125652760    04519 Cadherin signaling     125652760  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125652760  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     125652760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oed04131]     125652760    03036 Chromosome and associated proteins [BR:oed03036]     125652760   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oed04147]     125652760    04031 GTP-binding proteins [BR:oed04031]     125652760 Membrane trafficking [BR:oed04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     125652760  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     125652760   Macropinocytosis    Ras GTPases     125652760 Chromosome and associated proteins [BR:oed03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     125652760 Exosome [BR:oed04147]  Exosomal proteins   Exosomal proteins of microglial cells    125652760   Exosomal proteins of breast milk    125652760 GTP-binding proteins [BR:oed04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     125652760 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc MMR_HSR1 Motif Other DBs NCBI-GeneID:  125652760 NCBI-ProteinID:  XP_048738105 LinkDB All DBs Position 5:complement(71925330..71926355) Genome browser AA seq 185 aa AA seqDB search MVVAMQKSVQCTVVGDGLVGKSSLVKRLISGKFHQEYVATLKDDYVTKLSANGDAYTLNV SDIAGEHEDLSSLATPDIYIVCFSLVDDDSMDGVLNFWNPKLRTIGKHTPIVLVGTQSDL RQTGQTGHITTSDGLALAKSMRADAYVECSSKSGSGVLEAFQSALMASIRYKKRKANILK RVLGR NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atggtcgttgcaatgcagaaatctgttcagtgtacggttgttggagatggtttagttgga aagtcaagtttagttaaaagactgatcagtggaaagtttcaccaggagtatgtggccacc ctcaaggacgattacgttaccaaactgtccgctaatggggatgcatataccctgaatgtc tcagatattgctggggagcatgaggacttgtcttcattagcaacgccagacatctacatt gtttgcttcagccttgttgatgatgactcaatggacggcgtccttaatttttggaatccc aaactccggacaatcgggaagcataccccaatcgtccttgtaggaacacagtctgatttg agacaaactggtcaaactggacatattactacatccgatggcctggctttggcgaagtcg atgagagctgatgcctacgtggaatgttcttccaagtctggctccggagtgctggaagcc ttccagagcgccttaatggcgagcatcagatacaaaaagaggaaggccaacatcctaaaa cgtgttctaggacgatga

DBGET integrated database retrieval system