Ostrea edulis (European flat oyster): 125674993 Help Entry 125674993         CDS       T09123                                  Name (RefSeq) c-Myc-binding protein-like   KO K25550   c-Myc-binding protein Organism oed  Ostrea edulis (European flat oyster) Brite KEGG Orthology (KO) [BR:oed00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oed03037]     125674993 Cilium and associated proteins [BR:oed03037]  Motile cilia and associated proteins   Sperm associated proteins    125674993 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB TSC22 Cnn_1N bZIP_1 DivIC SlyX TACC_C DUF6549 DUF7518 Seryl_tRNA_N LPP Adaptin_binding NPV_P10 JIP_LZII HALZ YabA INO80F bZIP_2 Motif Other DBs NCBI-GeneID:  125674993 NCBI-ProteinID:  XP_048768411 LinkDB All DBs Position 3:complement(57404943..57412579) Genome browser AA seq 101 aa AA seqDB search MTTYRGADSKREEFRRYLEKAGVLDALTKVLVGLYEEPEKPNNALDFLKQHLGASGPETA DVEALKLEVTELRQKVEQLTEENREMKAKIQQFEEEPTQTA NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacaacgtacaggggagcagactccaaacgggaggaattccgaagatatttggaaaaa gctggtgtcttggatgccctcacaaaagttttagttggtctatatgaagaaccagaaaaa ccaaataatgcattagactttttgaagcagcatttaggagcctctggtccagaaacggct gatgtcgaagctttgaaattggaagtgacagagcttagacagaaagtagaacaactgact gaagaaaatcgggaaatgaaagcaaagatacaacagtttgaagaggaaccaacgcagact gcctaa

DBGET integrated database retrieval system