Osmerus eperlanus (European smelt): 134007068 Help Entry 134007068         CDS       T10927                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism oep  Osmerus eperlanus (European smelt) Pathway oep04382   Cornified envelope formation oep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oep00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     134007068  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134007068  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oep04147]     134007068 Exosome [BR:oep04147]  Exosomal proteins   Exosomal proteins of microglial cells    134007068 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 DAXX_hist_bd EH SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  134007068 NCBI-ProteinID:  XP_062302216 LinkDB All DBs Position 20:complement(9044923..9047105) Genome browser AA seq 100 aa AA seqDB search MPSELERSMESLITVFHRYASKEGSGNSLSRRELKDLMEHELSGFLKSQKDPAAIDKIMK DLDTNGDGEVNFEEFVSLVVGLSIACEQCYQMHLKKMGKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttctgaactggaacgctccatggagtccctgatcacggtgttccaccgttacgcc tccaaagaggggtccggtaactcgctcagccgccgtgagctcaaggacctgatggagcac gagctctctgggttcctcaagtctcagaaggaccccgctgcgatcgacaagatcatgaaa gatctggacaccaacggagatggagaggtgaactttgaggagtttgtgtctctggtggtg ggcctgtccatcgcctgtgagcagtgctaccagatgcacctgaagaagatggggaagaag tga

DBGET integrated database retrieval system