Osmerus eperlanus (European smelt): 134008706 Help Entry 134008706         CDS       T10927                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism oep  Osmerus eperlanus (European smelt) Pathway oep03082   ATP-dependent chromatin remodeling oep04217   Necroptosis Brite KEGG Orthology (KO) [BR:oep00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     134008706  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     134008706  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oep03036]     134008706   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oep04147]     134008706 Chromosome and associated proteins [BR:oep03036]  Eukaryotic type   Nucleosome assembly factors    Histones     134008706 Exosome [BR:oep04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134008706 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  134008706 NCBI-ProteinID:  XP_062304194 LinkDB All DBs Position 22:6136893..6137691 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKTK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcggaagaggcaaaaccgggggcaaagccagggcgaaggcaaagaccaggtcatct cgcgccgggctccagtttcccgtgggtcgagtgcatagacttcttcgcaagggcaactac gcgcaacgtgttggagctggcgcaccggtgtacttagccgctgttcttgagtatttgact gctgaaatccttgagttggccggcaatgctgcccgcgacaacaagaagactcgtattatc cctcgtcacctgcaactggccgtccgcaacgacgaagagttgaacaagcttctcggaggc gtcactatcgcccagggtggagttttgcctaacatccaggcagttcttttgcccaagaaa accgagaaagccgtcaaaacaaaataa

DBGET integrated database retrieval system