Osmerus eperlanus (European smelt): 134009994 Help Entry 134009994         CDS       T10927                                  Symbol pfn1 Name (RefSeq) profilin-1 isoform X1   KO K05759   profilin Organism oep  Osmerus eperlanus (European smelt) Pathway oep04810   Regulation of actin cytoskeleton oep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oep00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     134009994 (pfn1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134009994 (pfn1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oep04131]     134009994 (pfn1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oep04812]     134009994 (pfn1)    04147 Exosome [BR:oep04147]     134009994 (pfn1) Membrane trafficking [BR:oep04131]  Others   Actin-binding proteins    Others     134009994 (pfn1) Cytoskeleton proteins [BR:oep04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      134009994 (pfn1) Exosome [BR:oep04147]  Exosomal proteins   Proteins found in most exosomes    134009994 (pfn1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  134009994 NCBI-ProteinID:  XP_062305803 LinkDB All DBs Position 23:17600..21355 Genome browser AA seq 143 aa AA seqDB search MSGWDSWLASLTAGEKTFQEGAIVGHEPGAESVWTATPGGKLANITAAEIKMLVGKDRSP LFSGALTVGGVKCTALRDTLLSEDAKTLDLKTKVYDGQPDTFGISIAKTPNALVICKGQK ETHGGVLNKRVSEVAEQLRTAGY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcaggttgggattcgtggttggcaagtctgacggccggtgagaaaacgttccaagaa ggtgcgatcgtggggcacgagcctggagcagagtcagtgtggacggcgacaccagggggg aagcttgcaaacatcacggcagcagagatcaagatgctggtggggaaagaccgctccccc ctgttctctggggctctgacggtggggggggtgaagtgcaccgccctgagagacacgctg ctgtcggaagacgcgaaaaccctggacctgaaaaccaaggtctacgacggccagccggac accttcggcatctctatagccaagacccccaatgccctggtcatctgtaaagggcagaag gaaacccatggaggagttctgaacaagagagtgtctgaagtggctgagcagttacgaaca gcgggatactga

DBGET integrated database retrieval system