Osmerus eperlanus (European smelt): 134017232 Help Entry 134017232         CDS       T10927                                  Symbol dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism oep  Osmerus eperlanus (European smelt) Pathway oep04814   Motor proteins oep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oep00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     134017232 (dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134017232 (dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oep03037]     134017232 (dynlt3)    04812 Cytoskeleton proteins [BR:oep04812]     134017232 (dynlt3) Cilium and associated proteins [BR:oep03037]  Motile cilia and associated proteins   Dynein arm    134017232 (dynlt3) Cytoskeleton proteins [BR:oep04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      134017232 (dynlt3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  134017232 NCBI-ProteinID:  XP_062312633 LinkDB All DBs Position 3:4363788..4366122 Genome browser AA seq 114 aa AA seqDB search MEEYSGDEVSFNSDEASVSVKECIESIIGGVDYNQNKVNQWTASIVEHSLTQLVKQGRPF KFIVNCAIMQKSGAGLHTANSCYWDTATDGSCTVRWENRTMYCVVSVFAVAVTL NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaggagtattctggcgacgaggtgtctttcaattctgatgaggccagtgtgtcagtt aaggagtgtattgaaagcatcattggcggagtggactataaccagaacaaggtaaaccag tggaccgccagcatcgtggagcactctttgacacagctggtcaaacaaggaagaccattt aagttcatagtaaactgtgccatcatgcagaagagtggagcaggccttcacacagccaac tcctgctactgggacactgccactgatgggagctgcacggtcaggtgggagaatcgcacc atgtactgcgtcgtgagcgtgttcgcggttgccgtgacgttgtaa

DBGET integrated database retrieval system