Osmerus eperlanus (European smelt): 134021861 Help Entry 134021861         CDS       T10927                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism oep  Osmerus eperlanus (European smelt) Pathway oep03082   ATP-dependent chromatin remodeling oep04217   Necroptosis Brite KEGG Orthology (KO) [BR:oep00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     134021861  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     134021861  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oep03036]     134021861   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oep04147]     134021861 Chromosome and associated proteins [BR:oep03036]  Eukaryotic type   Nucleosome assembly factors    Histones     134021861 Exosome [BR:oep04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134021861 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  134021861 NCBI-ProteinID:  XP_062318924 LinkDB All DBs Position 6:1905876..1906286 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcggaagaggcaaaactggaggcaaagccagggctaaggccaagaccaggtcatcc cgcgccgggctccagttccccgtgggtcgtgttcacagacttctccgcaagggcaactat gctcaacgtgtgggagctggcgcacccgtctacctggcagccgtgctcgagtacctcacc gctgagatcctggagttggccgggaacgcggctcgtgacaacaagaagactcgtatcatc ccccgtcacctgcagctggccgtccgcaacgacgaggaactcaacaaacttctcggtggc gttacgatcgctcagggtggagtgctgcccaacatccaggcggtacttcttcctaagaag accgagaaggccgtcaaggccaagtag

DBGET integrated database retrieval system