Osmerus eperlanus (European smelt): 134023236 Help Entry 134023236         CDS       T10927                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism oep  Osmerus eperlanus (European smelt) Pathway oep04137   Mitophagy - animal oep04140   Autophagy - animal oep04144   Endocytosis oep04145   Phagosome oep04148   Efferocytosis oep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oep00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     134023236    04145 Phagosome     134023236    04140 Autophagy - animal     134023236    04137 Mitophagy - animal     134023236    04148 Efferocytosis     134023236  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134023236  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oep04131]     134023236   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oep04147]     134023236    04031 GTP-binding proteins [BR:oep04031]     134023236 Membrane trafficking [BR:oep04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     134023236 Exosome [BR:oep04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134023236   Exosomal proteins of other body fluids (saliva and urine)    134023236   Exosomal proteins of colorectal cancer cells    134023236   Exosomal proteins of bladder cancer cells    134023236 GTP-binding proteins [BR:oep04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     134023236 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  134023236 NCBI-ProteinID:  XP_062321179 LinkDB All DBs Position 1:complement(17549012..17555788) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSQESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccaggaagaaagtgcttctgaaagtcatcattctgggggattctggtgtgggc aagacctccctgatgaaccagtatgtgaacaagaagttcagcaaccaatacaaagccacg ataggagcagatttcttgaccaaggaggtgatggtggacgaccgactcgtcacaatgcag atctgggacacagctgggcaggagaggttccagtcattgggggtagcgttctaccgtggg gctgactgctgtgtgctggtgtttgatgtgacggctcccaacaccttcaagaccttagac agctggagagatgagttcctgatccaggctagccccagagacccggagaacttccctttt gtggttctaggcaacaagattgacctggagaacagacaggtgacaaccaagagggcccag gcctggtgtcaaagtaagaacaacatcccttacttcgagaccagcgctaaggaagccatc aatgtagagcaagccttccagaccattgcacgcaatgccctcaaacaggagacagaggtg gagttgtataatgaattccctgaacccattaaactggataggaatgacagagccaagcct tcacaagagagctgcagctgctga

DBGET integrated database retrieval system