Osmerus eperlanus (European smelt): 134023637 Help Entry 134023637         CDS       T10927                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism oep  Osmerus eperlanus (European smelt) Pathway oep04010   MAPK signaling pathway oep04144   Endocytosis oep04370   VEGF signaling pathway oep04510   Focal adhesion oep04517   IgSF CAM signaling oep04518   Integrin signaling oep04520   Adherens junction oep04530   Tight junction oep04810   Regulation of actin cytoskeleton oep04912   GnRH signaling pathway oep05100   Bacterial invasion of epithelial cells oep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oep00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134023637 (cdc42l)    04370 VEGF signaling pathway     134023637 (cdc42l)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     134023637 (cdc42l)    04518 Integrin signaling     134023637 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     134023637 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     134023637 (cdc42l)    04520 Adherens junction     134023637 (cdc42l)    04530 Tight junction     134023637 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     134023637 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     134023637 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134023637 (cdc42l)    05100 Bacterial invasion of epithelial cells     134023637 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oep04131]     134023637 (cdc42l)    03036 Chromosome and associated proteins [BR:oep03036]     134023637 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oep04147]     134023637 (cdc42l)    04031 GTP-binding proteins [BR:oep04031]     134023637 (cdc42l) Membrane trafficking [BR:oep04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     134023637 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     134023637 (cdc42l)   Macropinocytosis    Ras GTPases     134023637 (cdc42l) Chromosome and associated proteins [BR:oep03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     134023637 (cdc42l) Exosome [BR:oep04147]  Exosomal proteins   Exosomal proteins of microglial cells    134023637 (cdc42l)   Exosomal proteins of breast milk    134023637 (cdc42l) GTP-binding proteins [BR:oep04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     134023637 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  134023637 NCBI-ProteinID:  XP_062321901 LinkDB All DBs Position 7:20544376..20549096 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVREKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPLSPESGDKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaagtgtgtagtggtgggggatggtgccgtaggaaagacctgtctacta atttcctacacaaccaacaaattcccttcagaatatgttcccacggtgttcgataactat gctgtgacagtgatgattggaggggaaccgtatacactcgggcttttcgacacagcaggt caggaggattacgacaggctccgccctctcagctacccacagacggacgtcttcctggtc tgtttctcagtcgtatctccttcctcttttgagaatgtccgtgagaagtgggttcctgag atctcccaccactgcccccgcacccccttcctgctggtaggcacccaggtggacctgcga gacgacagcaacacagtggagaagctcgccaaaaataaacagcgccccctgtctcccgag agtggagacaagctagcccgtgacctccgggcagtcaaatacgtggagtgttccgccctc acacagagggggttgaaaaatgtttttgacgaggccatccttgctgctttggaacctcca gagactaaaccaaagaaacgctgcgtcctgctatag

DBGET integrated database retrieval system