Osmerus eperlanus (European smelt): 134024508 Help Entry 134024508         CDS       T10927                                  Name (RefSeq) calmodulin-alpha isoform X1   KO K02183   calmodulin Organism oep  Osmerus eperlanus (European smelt) Pathway oep04020   Calcium signaling pathway oep04070   Phosphatidylinositol signaling system oep04114   Oocyte meiosis oep04218   Cellular senescence oep04261   Adrenergic signaling in cardiomyocytes oep04270   Vascular smooth muscle contraction oep04371   Apelin signaling pathway oep04625   C-type lectin receptor signaling pathway oep04744   Phototransduction oep04910   Insulin signaling pathway oep04912   GnRH signaling pathway oep04916   Melanogenesis Brite KEGG Orthology (KO) [BR:oep00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     134024508    04020 Calcium signaling pathway     134024508    04070 Phosphatidylinositol signaling system     134024508  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     134024508    04218 Cellular senescence     134024508  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     134024508   09152 Endocrine system    04910 Insulin signaling pathway     134024508    04912 GnRH signaling pathway     134024508    04916 Melanogenesis     134024508   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     134024508    04270 Vascular smooth muscle contraction     134024508   09157 Sensory system    04744 Phototransduction     134024508  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oep01009]     134024508   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oep04131]     134024508    03036 Chromosome and associated proteins [BR:oep03036]     134024508   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oep04147]     134024508 Protein phosphatases and associated proteins [BR:oep01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      134024508 Membrane trafficking [BR:oep04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     134024508 Chromosome and associated proteins [BR:oep03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      134024508 Exosome [BR:oep04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    134024508 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH UPF0154 SPARC_Ca_bdg EFhand_Ca_insen EF-hand_11 Dockerin_1 Caleosin FCaBP_EF-hand Poly_export DUF1103 SPEF2_C TerB PhageMin_Tail Fe_hyd_lg_C PA_Ig-like Motif Other DBs NCBI-GeneID:  134024508 NCBI-ProteinID:  XP_062322957 LinkDB All DBs Position 8:complement(5967769..5978561) Genome browser AA seq 157 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEGEDELGLRAGVRVRLIW NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctaacagaggagcagattgcagagttcaaggaggcgttttccttattc gacaaggatggcgacggcaccatcacaaccaaggagctgggcacagtcatgcggtcgctg ggtcagaaccccacagaggcagagctgcaggacatgatcaacgaggtggacgccgacggc aacggaaccattgacttcccagagttcctcaccatgatggccagaaaaatgaaggacaca gacagcgaggaggagatccgtgaagctttccgggtatttgacaaggatggcaacggctac atcagcgcggcggagctgcgtcacgtgatgacgaacctgggggagaagctcacagacgag gaggtggacgagatgatcagagaagcagacattgacggagacggtcaggtcaactacgaa ggtgaggacgagttggggctgcgagctggggttagggtaaggttaatctggtag

DBGET integrated database retrieval system