Osmerus eperlanus (European smelt): 134026631 Help Entry 134026631         CDS       T10927                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism oep  Osmerus eperlanus (European smelt) Pathway oep04137   Mitophagy - animal oep04140   Autophagy - animal oep04144   Endocytosis oep04145   Phagosome oep04148   Efferocytosis oep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oep00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     134026631 (rab7a)    04145 Phagosome     134026631 (rab7a)    04140 Autophagy - animal     134026631 (rab7a)    04137 Mitophagy - animal     134026631 (rab7a)    04148 Efferocytosis     134026631 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134026631 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oep04131]     134026631 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oep04147]     134026631 (rab7a)    04031 GTP-binding proteins [BR:oep04031]     134026631 (rab7a) Membrane trafficking [BR:oep04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     134026631 (rab7a) Exosome [BR:oep04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134026631 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    134026631 (rab7a)   Exosomal proteins of colorectal cancer cells    134026631 (rab7a)   Exosomal proteins of bladder cancer cells    134026631 (rab7a) GTP-binding proteins [BR:oep04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     134026631 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  134026631 NCBI-ProteinID:  XP_062325506 LinkDB All DBs Position 1:complement(20506976..20511129) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatctaggaagaaagtccttcttaaagtcatcatccttggagactctggagttggt aagacctcattgatgaaccagtatgtaaataagaagttcagtaaccagtacaaagccaca ataggagctgatttcctcacgaaagaagtgatggtggatgacagacttgtcacaatgcag atctgggatacagcagggcaggagaggttccagtcactgggtgtggcgttctaccgtggg gctgactgctgtgtgctggtgtttgatgtgacggctcccaataccttcaagaccttagac agctggagagatgagttcctgatccaggccagtcccagagacccagagaacttccccttt gtggtactaggcaacaaaatcgacctggagaatagacaggtaacaaccaaacgagcacag gcctggtgtcagagcaagaacaacatcccttactttgagaccagtgccaaagaggccatc aatgtggaacaagcttttcagactattgcgcgcaacgctctgaaacaggaaactgaagtg gaattgtataatgagtttcctgaaccaattaagctggacaggaacgagcgagccaagcca tctgcagagacctgcagctgctga

DBGET integrated database retrieval system