Osmerus eperlanus (European smelt): 134028736 Help Entry 134028736         CDS       T10927                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism oep  Osmerus eperlanus (European smelt) Pathway oep04145   Phagocytosis oep04517   IgSF CAM signaling oep04814   Motor proteins oep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oep00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     134028736 (dynll2a)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     134028736 (dynll2a)   09142 Cell motility    04814 Motor proteins     134028736 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     134028736 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oep03037]     134028736 (dynll2a)    04812 Cytoskeleton proteins [BR:oep04812]     134028736 (dynll2a) Cilium and associated proteins [BR:oep03037]  Motile cilia and associated proteins   Dynein arm    134028736 (dynll2a) Cytoskeleton proteins [BR:oep04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      134028736 (dynll2a) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop Motif Other DBs NCBI-GeneID:  134028736 NCBI-ProteinID:  XP_062328484 LinkDB All DBs Position 11:14708998..14710763 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacagaaaggctgttatcaagaatgctgacatgtctgaggatatgcagcaagat gctgtggactgtgcaacccaggccatggagaaatacaacatagagaaagacattgctgcc tacgtcaagaaagagtttgacaagaagtataatcccacatggcattgcatagttgggagg aacttcggcagctacgtgacccatgagaccaagcacttcatttacttctacctgggtcaa gtggccatcctcctcttcaagtctggctga

DBGET integrated database retrieval system