Osmerus eperlanus (European smelt): 134031759 Help Entry 134031759         CDS       T10927                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism oep  Osmerus eperlanus (European smelt) Pathway oep04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:oep00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     134031759  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oep04121]     134031759    03400 DNA repair and recombination proteins [BR:oep03400]     134031759 Ubiquitin system [BR:oep04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      134031759    Cul5 complex      134031759 DNA repair and recombination proteins [BR:oep03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      134031759 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  134031759 NCBI-ProteinID:  XP_062331456 LinkDB All DBs Position 12:17786809..17791436 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRGKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLFKDDQVLDDSKTLGDC GFTNQTARPQAPATVGLAFRVGDDSFEQLQVESFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttgatgatcaggcgtgggaagaccacgatcttcacagacgctaaggag tccaccaccgtgtacgagctgaagcgcatcgtggagggcattctgaagagagcgccggag gaccagaggctcttcaaggatgaccaggttctggatgacagtaaaaccctgggagactgt ggcttcaccaaccagactgctcggccacaggcccccgctacagtagggctggctttccgt gtcggagatgactcgtttgagcaactgcaggtggagtccttctccagccctccagagctc ccagacgtgatgaagccccaggactccggcagcaccgccaacgagcaggccgtgcagtga

DBGET integrated database retrieval system