Osmerus eperlanus (European smelt): 134032637 Help Entry 134032637         CDS       T10927                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism oep  Osmerus eperlanus (European smelt) Pathway oep04010   MAPK signaling pathway oep04068   FoxO signaling pathway oep04081   Hormone signaling oep04114   Oocyte meiosis oep04140   Autophagy - animal oep04150   mTOR signaling pathway oep04810   Regulation of actin cytoskeleton oep04910   Insulin signaling pathway oep04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:oep00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134032637    04068 FoxO signaling pathway     134032637    04150 mTOR signaling pathway     134032637   09133 Signaling molecules and interaction    04081 Hormone signaling     134032637  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     134032637   09143 Cell growth and death    04114 Oocyte meiosis     134032637   09142 Cell motility    04810 Regulation of actin cytoskeleton     134032637  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     134032637    04914 Progesterone-mediated oocyte maturation     134032637  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oep04052]     134032637 Cytokines and neuropeptides [BR:oep04052]  Neuropeptides   Unclassified    134032637 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  134032637 NCBI-ProteinID:  XP_062332635 LinkDB All DBs Position 13:5224579..5227978 Genome browser AA seq 114 aa AA seqDB search MAAVPWAASMLLLLVLPSPGGASPPPQHLCGSHLVDALYLVCGSRGFFYSTHRSARKRDL QPLVGFLARRSRLESRLWKGPSEKSRDKLKVKRGIVERCCHKPCSLYDLEGYCG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggcggcggtgccatgggcggcgtccatgctgttgctcctggtgctgccctccccaggc ggggcctcgccgccccctcagcacctgtgcggctcccacctggtggacgccctctacctg gtgtgtggctccaggggcttcttctacagcacccaccgcagcgccaggaagagagacctc cagcccctcgtagggttcctggctaggaggagcaggctggagtccaggctgtggaaggga ccttcggagaagagccgcgacaagctcaaggtgaagcgaggcatcgtggagcggtgttgc cacaagccctgcagcctgtacgacctggagggctactgcggctga

DBGET integrated database retrieval system