Osmerus eperlanus (European smelt): 134040912 Help Entry 134040912         CDS       T10927                                  Symbol elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism oep  Osmerus eperlanus (European smelt) Pathway oep04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:oep00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     134040912 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oep04121]     134040912 (elob)    03400 DNA repair and recombination proteins [BR:oep03400]     134040912 (elob) Ubiquitin system [BR:oep04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      134040912 (elob)    Cul5 complex      134040912 (elob) DNA repair and recombination proteins [BR:oep03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      134040912 (elob) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  134040912 NCBI-ProteinID:  XP_062343069 LinkDB All DBs Position 2:complement(2208614..2211767) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKKAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPATVGLAFRLSDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatcaggcgtcacaagacgaccatcttcactgacgcaaaagag tccaccactgtctatgaactgaagcgcattgttgaggggatcttaaagaaggcaccagag gaacaaagactttataaggatgacatgttgcttgaggatagcaagactcttggagactgt ggatttacaaaccagacagccagacctcaggccccagcaacagttggactagctttccgc ctcagtgatgatgcttttgaacagctgagggttgagcccttttccagcccccctgagctc cctgacgtcatgaagccccaggactctggcagcacagccaatgagcaggccgtacagtga

DBGET integrated database retrieval system