Ornithinimicrobium faecis: NF556_12390 Help Entry NF556_12390       CDS       T10132                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ofa  Ornithinimicrobium faecis Pathway ofa01100   Metabolic pathways ofa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ofa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NF556_12390    00074 Mycolic acid biosynthesis     NF556_12390   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NF556_12390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Acyl-CoA-dh_C Motif Other DBs NCBI-ProteinID:  USQ78439 LinkDB All DBs Position 2669392..2669640 Genome browser AA seq 82 aa AA seqDB search MALNEQEILAGLAEIVNEETGIEADAVQMEKSFQEDLDIDSLSMMQVVVNAEDKFGVRIP DDEVKNLTHVKDAVAFITKAQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgaacgagcaggagatcctcgccggcctcgccgagatcgtcaacgaggagacg ggcatcgaggccgacgcggtccagatggagaagtccttccaggaggacctcgacatcgac tcgctgtccatgatgcaggtcgtcgtcaacgccgaggacaagttcggtgtccgcatcccc gacgacgaggtcaagaacctgacccacgtcaaggacgcggtcgccttcatcaccaaagcc cagggctga

DBGET integrated database retrieval system