Ornithinimicrobium faecis: NF556_17305 Help Entry NF556_17305       CDS       T10132                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ofa  Ornithinimicrobium faecis Pathway ofa00190   Oxidative phosphorylation ofa01100   Metabolic pathways Module ofa_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ofa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NF556_17305 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ofa00194]     NF556_17305 (atpE) Photosynthesis proteins [BR:ofa00194]  Photosystem and electron transport system   F-type ATPase [OT]    NF556_17305 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  USQ79346 LinkDB All DBs Position complement(3719370..3719585) Genome browser AA seq 71 aa AA seqDB search MTGDISLIGYGLAAIGPAIGVGLIFAAYINGVARQPEAQKILQPIAILGFALAEALAIFA LVLYFIRLPGA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgactggtgacatctccctcatcggctatggccttgctgccatcggcccggccatcggc gtgggcctgatcttcgctgcctacatcaatggcgttgcccgccagccggaggcccagaag atcctccagccgatcgccatcctgggcttcgcgctcgccgaggcgctcgcgatcttcgcc ctggtgctctacttcatccgactgcctggcgcctga

DBGET integrated database retrieval system