Ornithinimicrobium faecis: NF556_19205
Help
Entry
NF556_19205 CDS
T10132
Name
(GenBank) hypothetical protein
Organism
ofa Ornithinimicrobium faecis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
USQ79689
UniProt:
A0ABY4YSF2
LinkDB
All DBs
Position
4153050..4154675
Genome browser
AA seq
541 aa
AA seq
DB search
MDWKWVWLVLLLLVIAAAVWLLLRRPGGTNEVSGTSDPELRPHTNTDTAPPAQAGGYAAG
SESAAGPGAPAQDQQAAAPYDQAGSAPFDQQAGAQPAQDAGYQQHAGDAQDAGTQPGAGY
PEAGQTDYIAEGTADAPASDGGRSSDYAYTDTQPAAEVSDYSQEATYTDTATGEVGQADT
VAQGEAPADTTYGQAPAGDAYGQAPAGDAYGQAPVEDTAYAAEPTDPVTQGAEATDPATG
YAYTDTAPAAEAGDYSQEATYTDTATGEVAQADTVPAETDSVDPTYGQAAPADGTYTEAP
ADGTYTEAPADGTYTEAPYTEAPATDDGSGVSGGAVAAGAGAAAAGAGATAWATSRDDDA
AQTAEGAPAGDTNWGQGEPVQTSADFGADESGAAATEAGYAEPRTDAVYAETTDTTYAEE
PVVDTGAPPAGTTYGQDAPASGAAPEASPGATADTGDYGYDEARAGAAAGSYAQGPFGTG
SAEPGEDGSGPTGWSIKGNAGSMLFHTPESPSYEAARAEVWFETEEAAKAAGFAHWDRKQ
R
NT seq
1626 nt
NT seq
+upstream
nt +downstream
nt
atggattggaaatgggtctggcttgtgctcctgctgctggtgattgccgccgcagtctgg
ctgctgctgcgtcgcccgggaggcacaaacgaggtttcggggacatccgacccagagctt
cgtccacacaccaacaccgacacggccccgccggcccaggctgggggttacgccgcaggc
tcagagagtgcagcgggaccaggcgcaccagcccaggatcagcaggcggcggccccctac
gaccaggctggctcggcacctttcgaccagcaggcgggtgcccagcctgcgcaggacgct
ggctaccagcagcacgccggtgatgcgcaggacgccggcactcagcccggcgccggatat
cccgaggcgggtcagaccgactacatcgcagagggcactgcagacgcacctgcctccgac
ggcggtcgctcgagtgactacgcctacaccgacacccagccggcagccgaggtcagcgac
tactcgcaggaggcgacgtataccgacaccgccaccggcgaggtcggacaggcagacacg
gttgcgcagggcgaggcgccggccgacaccacctacggtcaggctcccgcgggcgacgcc
tacggtcaggctcccgcaggtgacgcctacggtcaggcccccgtcgaggacaccgcgtat
gccgctgagcccaccgatccggtgacgcagggcgccgaggccaccgacccggccacgggc
tacgcctacacggacacggcgccagcagccgaggctggtgactactcccaggaggcgacc
tacaccgacaccgccaccggcgaggttgcccaggcggacactgtccccgcggagacagac
tccgttgacccgacctacgggcaggctgctccggccgacggcacctacaccgaggcaccg
gccgacggcacctacaccgaggcacccgccgacggcacctacaccgaggccccctacacc
gaggcccccgcgacggatgacggttccggcgtctccggtggtgcggttgccgctggcgcc
ggcgctgctgccgccggggccggggcaacggcctgggccacctcgcgcgatgacgacgcg
gcacagaccgccgagggtgctcctgccggagacaccaactggggccagggcgagccggtg
cagacctcggcagacttcggggccgacgagagcggcgctgcggccaccgaggctggctat
gccgagccccgcacggacgccgtgtatgcggagaccacggacacgacctacgccgaggag
cccgtcgtcgacactggcgcgccccccgctgggacgacctacggccaggacgccccggcc
tccggtgccgccccggaggcttcgccaggtgccactgcggacaccggcgactacggctat
gacgaggcccgggccggcgccgccgctggcagctatgcccagggcccgttcggcaccgga
tcggccgagcctggtgaggacggctccggcccgaccgggtggtccatcaagggcaatgcg
ggatcgatgctcttccacacgcccgagtcaccctcctacgaggcagctcgcgccgaggtg
tggttcgagaccgaggaggcagccaaggccgctggcttcgcacactgggaccgcaagcaa
cgctga
DBGET
integrated database retrieval system