Oxalobacter formigenes: BRW83_2099 Help Entry BRW83_2099        CDS       T04835                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ofo  Oxalobacter formigenes Pathway ofo01100   Metabolic pathways ofo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ofo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BRW83_2099 (acpP)    00074 Mycolic acid biosynthesis     BRW83_2099 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BRW83_2099 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L50 DUF5783 TMEM210 Motif Other DBs NCBI-ProteinID:  ARQ46836 LinkDB All DBs Position complement(2248859..2249098) Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEDEIKLESSFVDDLGADSLDTVELVMALEDEFEIEIPDEQA EKITTVQQAVDYATANMQS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatcgaacaacgtgtaaagaaaatcgttgctgagcaactgggtgttgctgaa gacgaaatcaaactggaatcgtctttcgtggatgatctgggtgctgattcgcttgatacc gtagaactcgtcatggcgctggaagacgaatttgaaattgaaattccggacgaacaggct gaaaaaatcacgactgttcaacaggccgtcgattatgcaacagccaacatgcagtcctga

DBGET integrated database retrieval system