Ostrinia furnacalis (Asian corn borer): 114351507 Help Entry 114351507         CDS       T07986                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism ofu  Ostrinia furnacalis (Asian corn borer) Brite KEGG Orthology (KO) [BR:ofu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ofu03041]     114351507   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ofu04052]     114351507 Spliceosome [BR:ofu03041]  Complex B   Other components    Complex B specific factors     114351507 Cytokines and neuropeptides [BR:ofu04052]  Neuropeptides   Unclassified    114351507 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler PI3K_rbd OTU1_UBXL Ubiquitin_4 Motif Other DBs NCBI-GeneID:  114351507 NCBI-ProteinID:  XP_028158590 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MLEVTCNDRLGKKVRVKCNPDDTVGDLKKLIAAQTGTRYDKIVLKKWYTVFKDHIKLSDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgctcgaagtaacatgcaacgatcgtcttgggaagaaagtcagagtcaagtgcaatcca gacgacacagttggcgatttgaagaagctgatcgcagcccagactggcacacgatacgat aaaattgtattgaagaaatggtacacagtattcaaggaccacatcaaactctctgactat gaaatccatgatggcatgaatttggagttgtactaccaataa

DBGET integrated database retrieval system