Ostrinia furnacalis (Asian corn borer): 114353375 Help Entry 114353375         CDS       T07986                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ofu  Ostrinia furnacalis (Asian corn borer) Pathway ofu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ofu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114353375  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ofu04121]     114353375    03400 DNA repair and recombination proteins [BR:ofu03400]     114353375 Ubiquitin system [BR:ofu04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      114353375    Cul5 complex      114353375 DNA repair and recombination proteins [BR:ofu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114353375 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  114353375 NCBI-ProteinID:  XP_028161146 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVPPPSQMLFNKDSQLMEDEKTLAE YGLTSNTAKAQCPAPIGLALRKENGEFEALDLTAYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtctttctaatgattaggcgaaaaaagttaaccatattcaccgatgcgaaggac acgacgacggttttagaattaaagaaaatgatagaaggaattctgaaggtgcctccccct agccagatgctcttcaacaaagacagtcagctgatggaagacgaaaagaccctggctgag tacggtttgacatccaacactgctaaagcacaatgccctgcgcccatcggacttgcactt cggaaggaaaatggtgaatttgaagctttggatctgactgcatactcatccccaccagac ttgcccgatgtcatgaagtctcaggaaaccaacggccaggaacagatggaccagcactaa

DBGET integrated database retrieval system