Ostrinia furnacalis (Asian corn borer): 114353376 Help Entry 114353376         CDS       T07986                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism ofu  Ostrinia furnacalis (Asian corn borer) Pathway ofu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ofu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114353376  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ofu04121]     114353376    03400 DNA repair and recombination proteins [BR:ofu03400]     114353376 Ubiquitin system [BR:ofu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114353376    Cul5 complex      114353376 DNA repair and recombination proteins [BR:ofu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114353376 SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  114353376 NCBI-ProteinID:  XP_028161147 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search MLFNKDSQLMEDEKTLAEYGLTSNTAKAQCPAPIGLALRKENGEFEALDLTAYSSPPDLP DVMKSQETNGQEQMDQH NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgctcttcaacaaagacagtcagctgatggaagacgaaaagaccctggctgagtacggt ttgacatccaacactgctaaagcacaatgccctgcgcccatcggacttgcacttcggaag gaaaatggtgaatttgaagctttggatctgactgcatactcatccccaccagacttgccc gatgtcatgaagtctcaggaaaccaacggccaggaacagatggaccagcactaa

DBGET integrated database retrieval system