Ostrinia furnacalis (Asian corn borer): 114355507 Help Entry 114355507         CDS       T07986                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ofu  Ostrinia furnacalis (Asian corn borer) Pathway ofu04137   Mitophagy - animal ofu04140   Autophagy - animal ofu04144   Endocytosis ofu04145   Phagosome ofu04148   Efferocytosis Brite KEGG Orthology (KO) [BR:ofu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114355507    04145 Phagosome     114355507    04140 Autophagy - animal     114355507    04137 Mitophagy - animal     114355507    04148 Efferocytosis     114355507  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ofu04131]     114355507   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ofu04147]     114355507    04031 GTP-binding proteins [BR:ofu04031]     114355507 Membrane trafficking [BR:ofu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     114355507 Exosome [BR:ofu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114355507   Exosomal proteins of other body fluids (saliva and urine)    114355507   Exosomal proteins of colorectal cancer cells    114355507   Exosomal proteins of bladder cancer cells    114355507 GTP-binding proteins [BR:ofu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     114355507 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW nSTAND3 Septin AAA_16 AAA_24 PduV-EutP NACHT G-alpha AAA_7 AAA_5 AAA_22 ATPase_2 SRPRB NTPase_1 ABC_tran AAA_14 ATP-synt_ab NB-ARC TniB RNA_helicase PRK DAP3 Motif Other DBs NCBI-GeneID:  114355507 NCBI-ProteinID:  XP_028164180 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPENFPF VILGNKVDLENRAVSAKRAQQWCQSKNDIPYYETSAKEAVNVELAFQTIARNALAQETEA ELYNDFPDHIKLNANDNGRNKDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcacgaaaaaaggttcttttgaaggtaatcatccttggagatagtggcgtgggt aaaacttcgctgatgaatcagtttgtcaacaagaaattttccaaccagtacaaggcaaca ataggcgcagattttctcacgaaagaggtaatcgtcgatgataggatcgtcaccatgcaa atatgggatactgcaggtcaggaacgttttcaatccttgggagtcgctttctaccgtggg gcggattgttgcgtcttagtgtttgacgtaactgcccccaacacgttcaagtccttggag agttggagagacgagttcctgatccaggcttcgcctcgtgaccctgagaacttccctttc gtgatattaggcaataaggtagatctggaaaaccgtgctgtttctgccaaacgtgcacaa caatggtgtcaaagcaaaaatgatattccgtactatgaaacgagtgccaaagaagctgtg aatgtggagctagcattccagactatagctcgcaatgctctcgcccaggagacagaagca gagttgtacaacgacttcccagaccacatcaagcttaatgccaatgacaatggtcgcaat aaggatggagacaactgtgcctgctag

DBGET integrated database retrieval system