Ostrinia furnacalis (Asian corn borer): 114365888 Help Entry 114365888         CDS       T07986                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ofu  Ostrinia furnacalis (Asian corn borer) Pathway ofu04013   MAPK signaling pathway - fly ofu04145   Phagosome ofu04148   Efferocytosis ofu04310   Wnt signaling pathway ofu04517   IgSF CAM signaling ofu04518   Integrin signaling ofu04519   Cadherin signaling ofu04620   Toll-like receptor signaling pathway ofu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ofu00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     114365888    04310 Wnt signaling pathway     114365888   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     114365888    04518 Integrin signaling     114365888    04519 Cadherin signaling     114365888  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     114365888    04148 Efferocytosis     114365888  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114365888  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     114365888  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ofu04131]     114365888   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ofu04147]     114365888    04031 GTP-binding proteins [BR:ofu04031]     114365888 Membrane trafficking [BR:ofu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     114365888  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     114365888   Macropinocytosis    Ras GTPases     114365888  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     114365888 Exosome [BR:ofu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114365888   Exosomal proteins of other body fluids (saliva and urine)    114365888   Exosomal proteins of colorectal cancer cells    114365888   Exosomal proteins of bladder cancer cells    114365888 GTP-binding proteins [BR:ofu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     114365888 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  114365888 NCBI-ProteinID:  XP_028178390 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLAPITYPQGLGMAKEINAVKYLECSALTQKGLKTVFDEAIRAVLCPV QPIKRKRTCSLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgattaagtgtgtcgtggtcggagacggagccgtcggtaaaacatgtctgctc atcagttacaccacaaatgcgtttcccggggaatacatacctacagtattcgacaactac tcagcgaatgtgatggtagacggcaagcccatcaacctggggctatgggatacggcgggg caggaagactacgatcgacttcgaccactgtcctacccacagaccgacgtgttccttata tgcttctctctcgtcaaccctgcgtctttcgagaacgtgcgagctaagtggtaccccgag gtccggcatcactgcccgtcgacacccatcatccttgtgggcaccaagctcgatctccgc gaagacaaagacaccatcgagaagctgaaggacaagaaactagctcccatcacctacccc cagggtctgggcatggcaaaagagataaatgcggtgaagtacctggagtgttccgcgctg acgcagaaggggctgaagacggtgttcgacgaggccatccgcgccgtgctctgcccagtg cagcccatcaagcggaagcggacctgcagcctgctctaa

DBGET integrated database retrieval system