Otolemur garnettii (small-eared galago): 100941360 Help Entry 100941360         CDS       T07855                                  Name (RefSeq) metallothionein-1E   KO K14739   metallothionein 1/2 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04978   Mineral absorption Brite KEGG Orthology (KO) [BR:oga00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     100941360  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:oga03019]     100941360    03029 Mitochondrial biogenesis [BR:oga03029]     100941360 Messenger RNA biogenesis [BR:oga03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100941360 Mitochondrial biogenesis [BR:oga03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     100941360 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  100941360 NCBI-ProteinID:  XP_003792603 Ensembl:  ENSOGAG00000008587 UniProt:  H0WYS7 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCATGGSCSCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASEKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcgccactggtggctcctgcagctgtgctggctcctgcaaa tgcaaagagtgcaaatgcacgtcctgcaagaagagctgctgctcctgctgccctgtgggt tgtgccaagtgtgcccagggctgcatctgcaaaggggcatcagagaagtgcagctgctgt gcctga

DBGET integrated database retrieval system