Otolemur garnettii (small-eared galago): 100941637 Help Entry 100941637         CDS       T07855                                  Name (RefSeq) histone H2B type 1   KO K11252   histone H2B Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04613   Neutrophil extracellular trap formation oga05034   Alcoholism oga05203   Viral carcinogenesis oga05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oga00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100941637  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100941637   09163 Immune disease    05322 Systemic lupus erythematosus     100941637   09165 Substance dependence    05034 Alcoholism     100941637  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oga03036]     100941637   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100941637 Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100941637 Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100941637 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  100941637 NCBI-ProteinID:  XP_003801904 Ensembl:  ENSOGAG00000016394 UniProt:  H0XF87 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagcccgcgaaatccgctcctgcccctaagaagggctccaagaaggcggtgacc aaagcccagaagaaggacggcaagaagcgtaagcgcagccgcaaggagagttactccgtg tacgtgtacaaagtgctgaagcaggtccacccggacaccggcatctcttctaaagccatg ggcatcatgaattcgtttgtcaacgacatttttgagcgcatcgcaggcgaggcatctcgt ctggcgcattacaacaagcgctcgaccattacctcccgggagatccagaccgccgtgcgc ctgctgctgccgggagagctagccaagcatgctgtatccgaaggcaccaaggccgttacc aagtacaccagctctaagtga

DBGET integrated database retrieval system