Otolemur garnettii (small-eared galago): 100942503 Help Entry 100942503         CDS       T07855                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04613   Neutrophil extracellular trap formation oga05034   Alcoholism oga05203   Viral carcinogenesis oga05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oga00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100942503  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     100942503   09163 Immune disease    05322 Systemic lupus erythematosus     100942503   09165 Substance dependence    05034 Alcoholism     100942503  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oga03036]     100942503 Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100942503 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  100942503 NCBI-ProteinID:  XP_023368438 Ensembl:  ENSOGAG00000032167 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaagggtggtaagggccttggcaaaggaggcgcaaagcgccaccgc aaagtgctccgggataacatccagggtattaccaagccagctattcggcgcctggctagg cgtgggggtgtgaagcgcatctctggcttgatctacgaggagactcgcggggtcctcaaa gtgttcttggagaatgtgattcgggacgccgttacttacaccgagcacgccaagcgaaag actgttactgcaatggatgtggtgtatgccctcaaacgccaaggacggactttgtacggt ttcggcggctaa

DBGET integrated database retrieval system