KEGG   Otolemur garnettii (small-eared galago): 100942721
Entry
100942721         CDS       T07855                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
oga  Otolemur garnettii (small-eared galago)
Pathway
oga04014  Ras signaling pathway
oga04015  Rap1 signaling pathway
oga04020  Calcium signaling pathway
oga04022  cGMP-PKG signaling pathway
oga04024  cAMP signaling pathway
oga04070  Phosphatidylinositol signaling system
oga04114  Oocyte meiosis
oga04218  Cellular senescence
oga04261  Adrenergic signaling in cardiomyocytes
oga04270  Vascular smooth muscle contraction
oga04371  Apelin signaling pathway
oga04625  C-type lectin receptor signaling pathway
oga04713  Circadian entrainment
oga04720  Long-term potentiation
oga04722  Neurotrophin signaling pathway
oga04728  Dopaminergic synapse
oga04740  Olfactory transduction
oga04744  Phototransduction
oga04750  Inflammatory mediator regulation of TRP channels
oga04910  Insulin signaling pathway
oga04912  GnRH signaling pathway
oga04915  Estrogen signaling pathway
oga04916  Melanogenesis
oga04921  Oxytocin signaling pathway
oga04922  Glucagon signaling pathway
oga04924  Renin secretion
oga04925  Aldosterone synthesis and secretion
oga04970  Salivary secretion
oga04971  Gastric acid secretion
oga05010  Alzheimer disease
oga05012  Parkinson disease
oga05022  Pathways of neurodegeneration - multiple diseases
oga05031  Amphetamine addiction
oga05034  Alcoholism
oga05133  Pertussis
oga05152  Tuberculosis
oga05163  Human cytomegalovirus infection
oga05167  Kaposi sarcoma-associated herpesvirus infection
oga05170  Human immunodeficiency virus 1 infection
oga05200  Pathways in cancer
oga05214  Glioma
oga05417  Lipid and atherosclerosis
oga05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100942721
   04015 Rap1 signaling pathway
    100942721
   04371 Apelin signaling pathway
    100942721
   04020 Calcium signaling pathway
    100942721
   04070 Phosphatidylinositol signaling system
    100942721
   04024 cAMP signaling pathway
    100942721
   04022 cGMP-PKG signaling pathway
    100942721
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100942721
   04218 Cellular senescence
    100942721
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100942721
  09152 Endocrine system
   04910 Insulin signaling pathway
    100942721
   04922 Glucagon signaling pathway
    100942721
   04912 GnRH signaling pathway
    100942721
   04915 Estrogen signaling pathway
    100942721
   04921 Oxytocin signaling pathway
    100942721
   04916 Melanogenesis
    100942721
   04924 Renin secretion
    100942721
   04925 Aldosterone synthesis and secretion
    100942721
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100942721
   04270 Vascular smooth muscle contraction
    100942721
  09154 Digestive system
   04970 Salivary secretion
    100942721
   04971 Gastric acid secretion
    100942721
  09156 Nervous system
   04728 Dopaminergic synapse
    100942721
   04720 Long-term potentiation
    100942721
   04722 Neurotrophin signaling pathway
    100942721
  09157 Sensory system
   04744 Phototransduction
    100942721
   04740 Olfactory transduction
    100942721
   04750 Inflammatory mediator regulation of TRP channels
    100942721
  09159 Environmental adaptation
   04713 Circadian entrainment
    100942721
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100942721
  09162 Cancer: specific types
   05214 Glioma
    100942721
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100942721
   05163 Human cytomegalovirus infection
    100942721
   05167 Kaposi sarcoma-associated herpesvirus infection
    100942721
  09171 Infectious disease: bacterial
   05133 Pertussis
    100942721
   05152 Tuberculosis
    100942721
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100942721
   05012 Parkinson disease
    100942721
   05022 Pathways of neurodegeneration - multiple diseases
    100942721
  09165 Substance dependence
   05031 Amphetamine addiction
    100942721
   05034 Alcoholism
    100942721
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100942721
   05418 Fluid shear stress and atherosclerosis
    100942721
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oga01009]
    100942721
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oga04131]
    100942721
   03036 Chromosome and associated proteins [BR:oga03036]
    100942721
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oga04147]
    100942721
Protein phosphatases and associated proteins [BR:oga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100942721
Membrane trafficking [BR:oga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100942721
Chromosome and associated proteins [BR:oga03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100942721
Exosome [BR:oga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100942721
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EH EF-hand_FSTL1 EF-hand_EFHB_C EF-hand_11 DUF1103 Dockerin_1 RNA_pol_Rpb4 SPARC_Ca_bdg EF_EFCAB10_C DUF5580_M
Other DBs
NCBI-GeneID: 100942721
NCBI-ProteinID: XP_023372307
LinkDB
Position
Unknown
AA seq 113 aa
MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREASCVFDND
GNGCVSAAELRHVLTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 342 nt   +upstreamnt  +downstreamnt
atgaggtctcttggacagaatcccacagaagcagagttacaggacatgattaatgaagta
gatgctgatggtaacggcacgattgacttccctgaatttctgacaatgatggcaagaaaa
atgaaagacacagacagtgaagaagaaattagagaagcatcctgtgtgtttgataacgat
ggcaatggctgtgtcagcgcagcagagcttcgccatgtgctgacaaacctcggagagaag
ttaacagatgaagaggttgatgaaatgatcagagaagcagatattgatggtgatggtcaa
gtaaactatgaagagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system