Otolemur garnettii (small-eared galago): 100942721 Help Entry 100942721         CDS       T07855                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04014   Ras signaling pathway oga04015   Rap1 signaling pathway oga04020   Calcium signaling pathway oga04022   cGMP-PKG signaling pathway oga04024   cAMP signaling pathway oga04070   Phosphatidylinositol signaling system oga04114   Oocyte meiosis oga04218   Cellular senescence oga04261   Adrenergic signaling in cardiomyocytes oga04270   Vascular smooth muscle contraction oga04371   Apelin signaling pathway oga04625   C-type lectin receptor signaling pathway oga04713   Circadian entrainment oga04720   Long-term potentiation oga04722   Neurotrophin signaling pathway oga04728   Dopaminergic synapse oga04740   Olfactory transduction oga04744   Phototransduction oga04750   Inflammatory mediator regulation of TRP channels oga04910   Insulin signaling pathway oga04912   GnRH signaling pathway oga04915   Estrogen signaling pathway oga04916   Melanogenesis oga04921   Oxytocin signaling pathway oga04922   Glucagon signaling pathway oga04924   Renin secretion oga04925   Aldosterone synthesis and secretion oga04970   Salivary secretion oga04971   Gastric acid secretion oga05010   Alzheimer disease oga05012   Parkinson disease oga05022   Pathways of neurodegeneration - multiple diseases oga05031   Amphetamine addiction oga05034   Alcoholism oga05133   Pertussis oga05152   Tuberculosis oga05163   Human cytomegalovirus infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05170   Human immunodeficiency virus 1 infection oga05200   Pathways in cancer oga05214   Glioma oga05417   Lipid and atherosclerosis oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100942721    04015 Rap1 signaling pathway     100942721    04070 Phosphatidylinositol signaling system     100942721    04024 cAMP signaling pathway     100942721    04022 cGMP-PKG signaling pathway     100942721  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     100942721    04915 Estrogen signaling pathway     100942721    04921 Oxytocin signaling pathway     100942721    04924 Renin secretion     100942721    04925 Aldosterone synthesis and secretion     100942721   09154 Digestive system    04970 Salivary secretion     100942721    04971 Gastric acid secretion     100942721   09156 Nervous system    04728 Dopaminergic synapse     100942721    04720 Long-term potentiation     100942721    04722 Neurotrophin signaling pathway     100942721   09157 Sensory system    04740 Olfactory transduction     100942721    04750 Inflammatory mediator regulation of TRP channels     100942721   09159 Environmental adaptation    04713 Circadian entrainment     100942721  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100942721   09162 Cancer: specific types    05214 Glioma     100942721   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100942721    05163 Human cytomegalovirus infection     100942721    05167 Kaposi sarcoma-associated herpesvirus infection     100942721   09171 Infectious disease: bacterial    05133 Pertussis     100942721    05152 Tuberculosis     100942721   09164 Neurodegenerative disease    05010 Alzheimer disease     100942721    05012 Parkinson disease     100942721    05022 Pathways of neurodegeneration - multiple diseases     100942721   09165 Substance dependence    05031 Amphetamine addiction     100942721    05034 Alcoholism     100942721   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100942721    05418 Fluid shear stress and atherosclerosis     100942721  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oga01009]     100942721   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     100942721    03036 Chromosome and associated proteins [BR:oga03036]     100942721   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100942721 Protein phosphatases and associated proteins [BR:oga01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100942721 Membrane trafficking [BR:oga04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100942721 Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100942721 Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100942721 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EF-hand_11 DUF1103 Dockerin_1 SPARC_Ca_bdg RNA_pol_Rpb4 EF_EFCAB10_C DUF5580_M Motif Other DBs NCBI-GeneID:  100942721 NCBI-ProteinID:  XP_023372307 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREASCVFDND GNGCVSAAELRHVLTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaggtctcttggacagaatcccacagaagcagagttacaggacatgattaatgaagta gatgctgatggtaacggcacgattgacttccctgaatttctgacaatgatggcaagaaaa atgaaagacacagacagtgaagaagaaattagagaagcatcctgtgtgtttgataacgat ggcaatggctgtgtcagcgcagcagagcttcgccatgtgctgacaaacctcggagagaag ttaacagatgaagaggttgatgaaatgatcagagaagcagatattgatggtgatggtcaa gtaaactatgaagagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system