Otolemur garnettii (small-eared galago): 100943060 Help Entry 100943060         CDS       T07855                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga03030   DNA replication oga03410   Base excision repair oga03420   Nucleotide excision repair oga03430   Mismatch repair oga03440   Homologous recombination Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     100943060 (POLD4)    03410 Base excision repair     100943060 (POLD4)    03420 Nucleotide excision repair     100943060 (POLD4)    03430 Mismatch repair     100943060 (POLD4)    03440 Homologous recombination     100943060 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:oga03032]     100943060 (POLD4)    03400 DNA repair and recombination proteins [BR:oga03400]     100943060 (POLD4) DNA replication proteins [BR:oga03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     100943060 (POLD4) DNA repair and recombination proteins [BR:oga03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       100943060 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      100943060 (POLD4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  100943060 NCBI-ProteinID:  XP_003798375 Ensembl:  ENSOGAG00000028157 UniProt:  H0XW40 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRREGPAGHCAGELAPELGEEPQSPIKEEAELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLEPPPEVRQVLKTHPGDPRFQFSLWHLYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaagcggctcatcactgactcctaccctgttgtgaagaggagggaggggccc gctgggcactgcgcaggggagctggcaccggagctaggggaggagccgcagtcccccatc aaggaggaagcagagctggagctgctgaggcagtttgacttggcctggcagtatgggccc tgcacagggatcactaggctgcagcgctggcatcgggcagagcagatgggcttggagcct cccccagaggtgcgtcaggtgctgaagactcaccctggagatccccgcttccagttcagc ctctggcatctctatcccctatga

DBGET integrated database retrieval system