Otolemur garnettii (small-eared galago): 100944340 Help Entry 100944340         CDS       T07855                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga03008   Ribosome biogenesis in eukaryotes oga03013   Nucleocytoplasmic transport oga03015   mRNA surveillance pathway oga05014   Amyotrophic lateral sclerosis oga05164   Influenza A Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100944340 (NXT1)    03015 mRNA surveillance pathway     100944340 (NXT1)    03008 Ribosome biogenesis in eukaryotes     100944340 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100944340 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100944340 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:oga03019]     100944340 (NXT1)    03009 Ribosome biogenesis [BR:oga03009]     100944340 (NXT1) Messenger RNA biogenesis [BR:oga03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      100944340 (NXT1) Ribosome biogenesis [BR:oga03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     100944340 (NXT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NTF2 NXF_NTF2 Glyco_tran_10_N Cofilin_ADF Motif Other DBs NCBI-GeneID:  100944340 NCBI-ProteinID:  XP_003798523 Ensembl:  ENSOGAG00000000717 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS PSNSVWKIASDCFRFQDWAN NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcctccgtggatttcaagacatatgtggatcaggcctgccgagctgccgaggagttt gtcaacgtctactataccaccatggataagcggcggcgtttgctgtcccgcctgtatatg ggcacagccaccctggtttggaatggaaatgctgtttccggacaagaatctttgagtgag tttttcgaaatgttgccttccagtgagttccagattaatgtggtagactgccaacctgtt catgatgaagccacaccaagccagaccacagtccttgttgtgatctgtggaacggtgaag tttgagggcaacaaacaacgggacttcaaccagaacttcatcctgactgcccaagcctca cccagcaactctgtgtggaagattgcaagtgactgcttccggttccaagactgggccaac tag

DBGET integrated database retrieval system