Otolemur garnettii (small-eared galago): 100944877 Help Entry 100944877         CDS       T07855                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01523   Antifolate resistance oga04010   MAPK signaling pathway oga04060   Cytokine-cytokine receptor interaction oga04064   NF-kappa B signaling pathway oga04217   Necroptosis oga04380   Osteoclast differentiation oga04620   Toll-like receptor signaling pathway oga04621   NOD-like receptor signaling pathway oga04623   Cytosolic DNA-sensing pathway oga04625   C-type lectin receptor signaling pathway oga04640   Hematopoietic cell lineage oga04657   IL-17 signaling pathway oga04659   Th17 cell differentiation oga04668   TNF signaling pathway oga04750   Inflammatory mediator regulation of TRP channels oga04932   Non-alcoholic fatty liver disease oga04933   AGE-RAGE signaling pathway in diabetic complications oga04936   Alcoholic liver disease oga04940   Type I diabetes mellitus oga05010   Alzheimer disease oga05020   Prion disease oga05022   Pathways of neurodegeneration - multiple diseases oga05132   Salmonella infection oga05133   Pertussis oga05134   Legionellosis oga05135   Yersinia infection oga05140   Leishmaniasis oga05142   Chagas disease oga05143   African trypanosomiasis oga05144   Malaria oga05146   Amoebiasis oga05152   Tuberculosis oga05162   Measles oga05163   Human cytomegalovirus infection oga05164   Influenza A oga05168   Herpes simplex virus 1 infection oga05171   Coronavirus disease - COVID-19 oga05321   Inflammatory bowel disease oga05323   Rheumatoid arthritis oga05332   Graft-versus-host disease oga05417   Lipid and atherosclerosis oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100944877 (IL1B)    04064 NF-kappa B signaling pathway     100944877 (IL1B)    04668 TNF signaling pathway     100944877 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100944877 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100944877 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100944877 (IL1B)    04620 Toll-like receptor signaling pathway     100944877 (IL1B)    04621 NOD-like receptor signaling pathway     100944877 (IL1B)    04623 Cytosolic DNA-sensing pathway     100944877 (IL1B)    04625 C-type lectin receptor signaling pathway     100944877 (IL1B)    04659 Th17 cell differentiation     100944877 (IL1B)    04657 IL-17 signaling pathway     100944877 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100944877 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     100944877 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100944877 (IL1B)    05164 Influenza A     100944877 (IL1B)    05162 Measles     100944877 (IL1B)    05168 Herpes simplex virus 1 infection     100944877 (IL1B)    05163 Human cytomegalovirus infection     100944877 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     100944877 (IL1B)    05135 Yersinia infection     100944877 (IL1B)    05133 Pertussis     100944877 (IL1B)    05134 Legionellosis     100944877 (IL1B)    05152 Tuberculosis     100944877 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100944877 (IL1B)    05144 Malaria     100944877 (IL1B)    05140 Leishmaniasis     100944877 (IL1B)    05142 Chagas disease     100944877 (IL1B)    05143 African trypanosomiasis     100944877 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     100944877 (IL1B)    05321 Inflammatory bowel disease     100944877 (IL1B)    05332 Graft-versus-host disease     100944877 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100944877 (IL1B)    05020 Prion disease     100944877 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     100944877 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100944877 (IL1B)    05418 Fluid shear stress and atherosclerosis     100944877 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100944877 (IL1B)    04936 Alcoholic liver disease     100944877 (IL1B)    04932 Non-alcoholic fatty liver disease     100944877 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     100944877 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100944877 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100944877 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:oga00536]     100944877 (IL1B) Cytokines and neuropeptides [BR:oga04052]  Cytokines   Interleukins    100944877 (IL1B) Glycosaminoglycan binding proteins [BR:oga00536]  Heparan sulfate / Heparin   Cytokines    100944877 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  100944877 NCBI-ProteinID:  XP_012666485 Ensembl:  ENSOGAG00000005383 UniProt:  H0WRY4 LinkDB All DBs Position Unknown AA seq 268 aa AA seqDB search MAAVPELTSEMMDYYSGNEDDLFFEAEGSKQMKCSFQDLDLCPTDGGIQLHVSHQHYNKD FRQVVSLIVAMEKLRNKPVLCPKAFQDGDLSTFFPFIFEEEPIFFDTCDDDWVCDGRVRS LNCTLRDAHQKCLVMSGAYQLKALHLQGQDLNHQVVFSMSFVQGDENSDKIPVALGLKEK NLYLSCVMKDEKPILQLESVDPKSYPKRKMEKRFVFNKIETNNKVEFESAQFPNWYISTS QAQNMPVFLGKTKGGEDIVDFTMQFLSS NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacctgaactcaccagtgaaatgatggattactacagtggcaatgaggat gacctcttctttgaagctgaaggctccaaacagatgaagtgctccttccaggacctggat ctctgccctacggatgggggcatccagctacacgtctcccaccagcactacaacaaggat ttcaggcaggttgtgtcgctgatcgtggccatggagaagctgaggaacaagccagttctc tgcccaaaggccttccaggatggcgacctgagcaccttctttcccttcatctttgaagaa gaacccatcttctttgacacatgtgacgatgactgggtgtgtgatggacgtgtacggtca ctgaactgcacactccgggatgctcatcaaaaatgcctggtgatgtctggcgcatatcag ctgaaagctctccacctccagggacaggatctgaaccaccaagtggtgttttccatgagc tttgtacaaggagatgaaaatagtgacaaaatacctgtggcgctgggcctcaaggaaaag aatctgtacctttcctgcgtgatgaaggatgagaagcccatcctacagctagagagtgtg gaccctaaaagttacccaaagaggaagatggaaaagcgatttgtcttcaacaagatagaa accaacaacaaggtggaatttgagtctgcccagttccccaactggtacatcagcacctct caagcgcaaaacatgcccgtcttcctgggaaagaccaaaggtggtgaggatatagtggac ttcaccatgcaattcttatcttcctga

DBGET integrated database retrieval system