Otolemur garnettii (small-eared galago): 100945114 Help Entry 100945114         CDS       T07855                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04621   NOD-like receptor signaling pathway oga05012   Parkinson disease oga05132   Salmonella infection oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100945114  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100945114   09164 Neurodegenerative disease    05012 Parkinson disease     100945114   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100945114  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:oga03110]     100945114 Chaperones and folding catalysts [BR:oga03110]  Protein folding catalysts   Protein disulfide isomerase    100945114 SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 DIM1 OST3_OST6 A6-like_Thioredoxin-like_C AhpC-TSA Thioredoxin_7 Thioredoxin_9 Glutaredoxin Redoxin NODP Motif Other DBs NCBI-GeneID:  100945114 NCBI-ProteinID:  XP_003785265 Ensembl:  ENSOGAG00000009165 UniProt:  H0X010 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVKQIESKCAFKEALDAAGDKLVVVDFSATWCGPCKMIKPFYHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtgtgcttttaaggaagccttggatgctgctggagat aaacttgtagtagttgacttctcggccacgtggtgtgggccttgcaaaatgatcaagcct ttctatcattccctctctgaaaagtattccaacgtggtgttccttgaagtagacgtggat gactgtcaggatgttgcttcagagtgtgaggtcaaatgcatgccgactttccagtttttt aaaaagggacaaaaggtgggtgagttttctggagctaataaggaaaagcttgaagccacc attaatgaattagtctaa

DBGET integrated database retrieval system