Otolemur garnettii (small-eared galago): 100945309 Help Entry 100945309         CDS       T07855                                  Name (RefSeq) interferon alpha-5-like   KO K05414   interferon alpha Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04060   Cytokine-cytokine receptor interaction oga04151   PI3K-Akt signaling pathway oga04217   Necroptosis oga04620   Toll-like receptor signaling pathway oga04621   NOD-like receptor signaling pathway oga04622   RIG-I-like receptor signaling pathway oga04623   Cytosolic DNA-sensing pathway oga04630   JAK-STAT signaling pathway oga04650   Natural killer cell mediated cytotoxicity oga04936   Alcoholic liver disease oga05152   Tuberculosis oga05160   Hepatitis C oga05161   Hepatitis B oga05162   Measles oga05163   Human cytomegalovirus infection oga05164   Influenza A oga05165   Human papillomavirus infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05168   Herpes simplex virus 1 infection oga05169   Epstein-Barr virus infection oga05170   Human immunodeficiency virus 1 infection oga05171   Coronavirus disease - COVID-19 oga05200   Pathways in cancer oga05320   Autoimmune thyroid disease oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100945309    04151 PI3K-Akt signaling pathway     100945309   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100945309  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100945309  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100945309    04621 NOD-like receptor signaling pathway     100945309    04622 RIG-I-like receptor signaling pathway     100945309    04623 Cytosolic DNA-sensing pathway     100945309    04650 Natural killer cell mediated cytotoxicity     100945309  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100945309   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100945309    05161 Hepatitis B     100945309    05160 Hepatitis C     100945309    05171 Coronavirus disease - COVID-19     100945309    05164 Influenza A     100945309    05162 Measles     100945309    05168 Herpes simplex virus 1 infection     100945309    05163 Human cytomegalovirus infection     100945309    05167 Kaposi sarcoma-associated herpesvirus infection     100945309    05169 Epstein-Barr virus infection     100945309    05165 Human papillomavirus infection     100945309   09171 Infectious disease: bacterial    05152 Tuberculosis     100945309   09163 Immune disease    05320 Autoimmune thyroid disease     100945309   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100945309   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100945309  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100945309 Cytokines and neuropeptides [BR:oga04052]  Cytokines   Interferons    100945309 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF2509 Prok-E2_A Motif Other DBs NCBI-GeneID:  100945309 NCBI-ProteinID:  XP_023364248 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTLPFSVLVALVVLSGSSICSLGCDLPQSHSLGNRRALIPLVHMRRISPFSCLKDRSDFR FPQEELRGKQLQKAQAISVLHEMTQQTFNLFSTNDSSEAWNKTLLDQFHTCLHQQLNELE ACLMEEGVEETALMHQNSTLTMRSYFQRITLYLKEKKYSPCAWEVVRAEILRLFSSTTSL QERLKRVE NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccttgcccttctctgtcctggtggccctggtggtactcagcggctcgtccatctgc tctctgggctgtgatctgcctcagtcccacagcctgggcaacaggagggccttgattccc ctggttcatatgaggagaatctctcctttctcctgcctcaaggacaggagtgacttcaga ttcccccaggaggagttgcgtggcaagcagctccagaaggctcaagccatctctgtcctt catgagatgacccagcagaccttcaacctcttcagcacaaatgactcatctgaggcttgg aacaagaccctcctggaccagttccacacttgcctccatcagcagctgaatgagctggaa gcctgtctgatggaagaaggagtggaagagactgccctcatgcaccagaactccacactg accatgaggagctacttccaaagaatcactctctatctgaaagagaagaaatacagccct tgtgcctgggaggtggtcagagcagaaatcctgagattgttttcttcaacaacaagcttg caagaaagattaaagagagttgaatga

DBGET integrated database retrieval system