Otolemur garnettii (small-eared galago): 100946348 Help Entry 100946348         CDS       T07855                                  Symbol IL13 Name (RefSeq) interleukin-13   KO K05435   interleukin 13 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04060   Cytokine-cytokine receptor interaction oga04630   JAK-STAT signaling pathway oga04657   IL-17 signaling pathway oga04658   Th1 and Th2 cell differentiation oga04664   Fc epsilon RI signaling pathway oga05200   Pathways in cancer oga05310   Asthma oga05321   Inflammatory bowel disease Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100946348 (IL13)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100946348 (IL13)  09150 Organismal Systems   09151 Immune system    04658 Th1 and Th2 cell differentiation     100946348 (IL13)    04657 IL-17 signaling pathway     100946348 (IL13)    04664 Fc epsilon RI signaling pathway     100946348 (IL13)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100946348 (IL13)   09163 Immune disease    05310 Asthma     100946348 (IL13)    05321 Inflammatory bowel disease     100946348 (IL13)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100946348 (IL13) Cytokines and neuropeptides [BR:oga04052]  Cytokines   Interleukins    100946348 (IL13) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL13 Motif Other DBs NCBI-GeneID:  100946348 NCBI-ProteinID:  XP_012662607 Ensembl:  ENSOGAG00000015504 UniProt:  B5FW67 LinkDB All DBs Position Unknown AA seq 157 aa AA seqDB search MKAGFRGSGPAVGLGSSLPALALGSMALWLTMVIALTCLGGLASPGPVPRLTKLKELIEE LDNITQNQRAPLCNGSMVWSVNLTTDIYCAALESLINVSSCSAIQRTQRILGGLCKQKDL PGVPSSHIRDTKIEVAQFIKDLLRHLKKRFRDANVKA NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgaaggctggcttccgggggtcagggcctgcagttgggctgggcagcagtcttcctgcg ttggctctgggctccatggcgctgtggttgaccatggtcattgctcttacctgccttggt ggccttgcctccccaggccctgtgcctcgccttacgaaactcaaggaactcattgaggaa ctggacaatatcactcagaaccagagggcacccctctgcaatggaagcatggtgtggagc gtcaacctgacaactgacatatactgtgcagccctggaatccctcatcaatgtgtcgagt tgcagtgccatccagaggacccagaggatactgggaggactctgcaagcaaaaggactta cctggggttcccagctcccacatccgagacaccaaaattgaagtggcccagttcataaag gacctgctcagacatttaaagaaacgtttccgtgatgcaaatgtcaaagcctga

DBGET integrated database retrieval system