Otolemur garnettii (small-eared galago): 100947991 Help Entry 100947991         CDS       T07855                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04024   cAMP signaling pathway oga04062   Chemokine signaling pathway oga04064   NF-kappa B signaling pathway oga04210   Apoptosis oga04380   Osteoclast differentiation oga04620   Toll-like receptor signaling pathway oga04621   NOD-like receptor signaling pathway oga04622   RIG-I-like receptor signaling pathway oga04623   Cytosolic DNA-sensing pathway oga04625   C-type lectin receptor signaling pathway oga04657   IL-17 signaling pathway oga04658   Th1 and Th2 cell differentiation oga04659   Th17 cell differentiation oga04660   T cell receptor signaling pathway oga04662   B cell receptor signaling pathway oga04668   TNF signaling pathway oga04722   Neurotrophin signaling pathway oga04920   Adipocytokine signaling pathway oga04926   Relaxin signaling pathway oga04931   Insulin resistance oga04936   Alcoholic liver disease oga05132   Salmonella infection oga05134   Legionellosis oga05135   Yersinia infection oga05140   Leishmaniasis oga05142   Chagas disease oga05145   Toxoplasmosis oga05160   Hepatitis C oga05161   Hepatitis B oga05162   Measles oga05163   Human cytomegalovirus infection oga05164   Influenza A oga05166   Human T-cell leukemia virus 1 infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05168   Herpes simplex virus 1 infection oga05169   Epstein-Barr virus infection oga05170   Human immunodeficiency virus 1 infection oga05171   Coronavirus disease - COVID-19 oga05200   Pathways in cancer oga05203   Viral carcinogenesis oga05208   Chemical carcinogenesis - reactive oxygen species oga05215   Prostate cancer oga05220   Chronic myeloid leukemia oga05222   Small cell lung cancer oga05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100947991 (NFKBIA)    04668 TNF signaling pathway     100947991 (NFKBIA)    04024 cAMP signaling pathway     100947991 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100947991 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100947991 (NFKBIA)    04621 NOD-like receptor signaling pathway     100947991 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     100947991 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     100947991 (NFKBIA)    04625 C-type lectin receptor signaling pathway     100947991 (NFKBIA)    04660 T cell receptor signaling pathway     100947991 (NFKBIA)    04658 Th1 and Th2 cell differentiation     100947991 (NFKBIA)    04659 Th17 cell differentiation     100947991 (NFKBIA)    04657 IL-17 signaling pathway     100947991 (NFKBIA)    04662 B cell receptor signaling pathway     100947991 (NFKBIA)    04062 Chemokine signaling pathway     100947991 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100947991 (NFKBIA)    04926 Relaxin signaling pathway     100947991 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     100947991 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     100947991 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100947991 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     100947991 (NFKBIA)    05203 Viral carcinogenesis     100947991 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100947991 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     100947991 (NFKBIA)    05215 Prostate cancer     100947991 (NFKBIA)    05222 Small cell lung cancer     100947991 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100947991 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     100947991 (NFKBIA)    05161 Hepatitis B     100947991 (NFKBIA)    05160 Hepatitis C     100947991 (NFKBIA)    05171 Coronavirus disease - COVID-19     100947991 (NFKBIA)    05164 Influenza A     100947991 (NFKBIA)    05162 Measles     100947991 (NFKBIA)    05168 Herpes simplex virus 1 infection     100947991 (NFKBIA)    05163 Human cytomegalovirus infection     100947991 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     100947991 (NFKBIA)    05169 Epstein-Barr virus infection     100947991 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     100947991 (NFKBIA)    05135 Yersinia infection     100947991 (NFKBIA)    05134 Legionellosis     100947991 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100947991 (NFKBIA)    05140 Leishmaniasis     100947991 (NFKBIA)    05142 Chagas disease     100947991 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100947991 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100947991 (NFKBIA)    04931 Insulin resistance     100947991 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oga03000]     100947991 (NFKBIA)    04131 Membrane trafficking [BR:oga04131]     100947991 (NFKBIA) Transcription factors [BR:oga03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     100947991 (NFKBIA) Membrane trafficking [BR:oga04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100947991 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  100947991 NCBI-ProteinID:  XP_003792016 Ensembl:  ENSOGAG00000003716 UniProt:  H0WNB2 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPVEHAPEWAMEGARDGLKKERLLDDRHDSGLDSMKDEDYEQMVRELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKTLTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TKQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCTSQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVFGGQRLKL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagccggtcgagcacgccccggagtgggccatggagggggcccgggatgggctg aagaaggagcgactgctagacgaccgccacgacagcggcctggactccatgaaggacgag gactatgagcagatggtcagggagctgcgggagattcgcctggagccgcaggaggctccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagaaaagacactgaccatggaagtgattcgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaagcagcctgaaattgctgaggcacttctggaagctggctgtgatcctgaacttcga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcacctcccaacacctgcactccatcctgcaggccaccaac tacaatggccacacgtgtctgcatttagcctctatccatggctacctgggcatcgtggag cttttggtgtctttgggtgctgatgtcaatgctcaggaaccctgtaatggccggactgcc ctccaccttgcagtggacctgcagaaccctgacctggtgtcactcctattgaagtgtggg gctgatgtcaacagagttacctaccagggctattccccctaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggaaagctatgacacagagtctgagttcacagaggatgagctg ccctatgacgactgtgtgtttggaggccagcgcctgaaattatga

DBGET integrated database retrieval system