Otolemur garnettii (small-eared galago): 100948262 Help Entry 100948262         CDS       T07855                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04010   MAPK signaling pathway oga04014   Ras signaling pathway oga04015   Rap1 signaling pathway oga04024   cAMP signaling pathway oga04072   Phospholipase D signaling pathway oga04137   Mitophagy - animal oga04140   Autophagy - animal oga04218   Cellular senescence oga04360   Axon guidance oga04371   Apelin signaling pathway oga04625   C-type lectin receptor signaling pathway oga04810   Regulation of actin cytoskeleton oga05132   Salmonella infection oga05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100948262 (RRAS)    04015 Rap1 signaling pathway     100948262 (RRAS)    04072 Phospholipase D signaling pathway     100948262 (RRAS)    04024 cAMP signaling pathway     100948262 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100948262 (RRAS)    04137 Mitophagy - animal     100948262 (RRAS)  09150 Organismal Systems   09158 Development and regeneration    04360 Axon guidance     100948262 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100948262 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oga04031]     100948262 (RRAS) GTP-binding proteins [BR:oga04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100948262 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  100948262 NCBI-ProteinID:  XP_003801528 Ensembl:  ENSOGAG00000010243 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGQPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDYPVVLVGNKADLETQRQVPRSEALAFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKFQEQELPPSPPSAPKKKGGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggaccgggcgggggcagccccggggcggggggccggga cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccaattcatccagtcctacttcgtgtctgactacgacccc actatcgaggactcctacacaaagatctgcactgtggatggcatcccggcccggctggac attctggacaccgcaggccaggaggaattcggggccatgcgggagcagtatatgcgcgct ggccacggcttcctgctggtatttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacacagatcctccgagtcaaggaccgggatgactaccccgttgtgctggtt gggaacaaggcagacttggagacacagcgccaggtcccccgatctgaagcactggccttc agcgcttcccaccatgtggcttactttgaggcctcagccaaactgcgcctcaatgtggat gaggccttcgagcagctggtgcgagctgtccggaaattccaagaacaggagctcccaccc agtccccccagtgctcccaagaagaagggtgggggttgcccctgcgtcctcctgtag

DBGET integrated database retrieval system