Otolemur garnettii (small-eared galago): 100948262 Help Entry 100948262         CDS       T07855                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04010   MAPK signaling pathway oga04014   Ras signaling pathway oga04015   Rap1 signaling pathway oga04024   cAMP signaling pathway oga04072   Phospholipase D signaling pathway oga04137   Mitophagy - animal oga04140   Autophagy - animal oga04218   Cellular senescence oga04360   Axon guidance oga04371   Apelin signaling pathway oga04625   C-type lectin receptor signaling pathway oga04810   Regulation of actin cytoskeleton oga05132   Salmonella infection oga05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100948262 (RRAS)    04014 Ras signaling pathway     100948262 (RRAS)    04015 Rap1 signaling pathway     100948262 (RRAS)    04371 Apelin signaling pathway     100948262 (RRAS)    04072 Phospholipase D signaling pathway     100948262 (RRAS)    04024 cAMP signaling pathway     100948262 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100948262 (RRAS)    04137 Mitophagy - animal     100948262 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     100948262 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100948262 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100948262 (RRAS)   09158 Development and regeneration    04360 Axon guidance     100948262 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100948262 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100948262 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oga04031]     100948262 (RRAS) GTP-binding proteins [BR:oga04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100948262 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  100948262 NCBI-ProteinID:  XP_003801528 Ensembl:  ENSOGAG00000010243 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGQPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDYPVVLVGNKADLETQRQVPRSEALAFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKFQEQELPPSPPSAPKKKGGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggaccgggcgggggcagccccggggcggggggccggga cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccaattcatccagtcctacttcgtgtctgactacgacccc actatcgaggactcctacacaaagatctgcactgtggatggcatcccggcccggctggac attctggacaccgcaggccaggaggaattcggggccatgcgggagcagtatatgcgcgct ggccacggcttcctgctggtatttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacacagatcctccgagtcaaggaccgggatgactaccccgttgtgctggtt gggaacaaggcagacttggagacacagcgccaggtcccccgatctgaagcactggccttc agcgcttcccaccatgtggcttactttgaggcctcagccaaactgcgcctcaatgtggat gaggccttcgagcagctggtgcgagctgtccggaaattccaagaacaggagctcccaccc agtccccccagtgctcccaagaagaagggtgggggttgcccctgcgtcctcctgtag

DBGET integrated database retrieval system