Entry |
|
Symbol |
GNG12
|
Name |
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
|
KO |
K04347 | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 |
|
Organism |
oga Otolemur garnettii (small-eared galago)
|
Pathway |
oga04723 | Retrograde endocannabinoid signaling |
oga04810 | Regulation of actin cytoskeleton |
oga05163 | Human cytomegalovirus infection |
oga05167 | Kaposi sarcoma-associated herpesvirus infection |
oga05170 | Human immunodeficiency virus 1 infection |
|
Brite |
KEGG Orthology (KO) [BR:oga00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
100950477 (GNG12)
04014 Ras signaling pathway
100950477 (GNG12)
04371 Apelin signaling pathway
100950477 (GNG12)
04151 PI3K-Akt signaling pathway
100950477 (GNG12)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
100950477 (GNG12)
04081 Hormone signaling
100950477 (GNG12)
09140 Cellular Processes
09142 Cell motility
04810 Regulation of actin cytoskeleton
100950477 (GNG12)
09150 Organismal Systems
09151 Immune system
04062 Chemokine signaling pathway
100950477 (GNG12)
09152 Endocrine system
04926 Relaxin signaling pathway
100950477 (GNG12)
09156 Nervous system
04724 Glutamatergic synapse
100950477 (GNG12)
04727 GABAergic synapse
100950477 (GNG12)
04725 Cholinergic synapse
100950477 (GNG12)
04728 Dopaminergic synapse
100950477 (GNG12)
04726 Serotonergic synapse
100950477 (GNG12)
04723 Retrograde endocannabinoid signaling
100950477 (GNG12)
09159 Environmental adaptation
04713 Circadian entrainment
100950477 (GNG12)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
100950477 (GNG12)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
100950477 (GNG12)
05163 Human cytomegalovirus infection
100950477 (GNG12)
05167 Kaposi sarcoma-associated herpesvirus infection
100950477 (GNG12)
09165 Substance dependence
05032 Morphine addiction
100950477 (GNG12)
05034 Alcoholism
100950477 (GNG12)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:oga04147]
100950477 (GNG12)
04031 GTP-binding proteins [BR:oga04031]
100950477 (GNG12)
Exosome [BR:oga04147]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
100950477 (GNG12)
Exosomal proteins of colorectal cancer cells
100950477 (GNG12)
GTP-binding proteins [BR:oga04031]
Heterotrimeric G-proteins
Gamma Subunits
Gamma [OT]
100950477 (GNG12)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
72 aa
MSSKTASTNSTAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCTIL |
NT seq |
219 nt +upstreamnt +downstreamnt
atgtccagcaaaactgcgagcaccaacagcacggcccaggcgcggaggaccgtgcagcag
ctgaggctggaggcctccatcgagaggatcaaggtttcgaaagcatcagcagacctcatg
tcctactgtgaggaacacgccaggagtgaccctttgctgatagggataccaacttcagaa
aaccctttcaaggataaaaaaacttgcaccatcttatag |