KEGG   Otolemur garnettii (small-eared galago): 100951369
Entry
100951369         CDS       T07855                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
oga  Otolemur garnettii (small-eared galago)
Pathway
oga04010  MAPK signaling pathway
oga04014  Ras signaling pathway
oga04015  Rap1 signaling pathway
oga04024  cAMP signaling pathway
oga04062  Chemokine signaling pathway
oga04071  Sphingolipid signaling pathway
oga04145  Phagosome
oga04148  Efferocytosis
oga04151  PI3K-Akt signaling pathway
oga04310  Wnt signaling pathway
oga04360  Axon guidance
oga04370  VEGF signaling pathway
oga04380  Osteoclast differentiation
oga04510  Focal adhesion
oga04517  IgSF CAM signaling
oga04518  Integrin signaling
oga04520  Adherens junction
oga04530  Tight junction
oga04613  Neutrophil extracellular trap formation
oga04620  Toll-like receptor signaling pathway
oga04650  Natural killer cell mediated cytotoxicity
oga04662  B cell receptor signaling pathway
oga04664  Fc epsilon RI signaling pathway
oga04666  Fc gamma R-mediated phagocytosis
oga04670  Leukocyte transendothelial migration
oga04722  Neurotrophin signaling pathway
oga04810  Regulation of actin cytoskeleton
oga04932  Non-alcoholic fatty liver disease
oga04933  AGE-RAGE signaling pathway in diabetic complications
oga04972  Pancreatic secretion
oga05014  Amyotrophic lateral sclerosis
oga05020  Prion disease
oga05022  Pathways of neurodegeneration - multiple diseases
oga05100  Bacterial invasion of epithelial cells
oga05132  Salmonella infection
oga05135  Yersinia infection
oga05163  Human cytomegalovirus infection
oga05167  Kaposi sarcoma-associated herpesvirus infection
oga05169  Epstein-Barr virus infection
oga05170  Human immunodeficiency virus 1 infection
oga05200  Pathways in cancer
oga05203  Viral carcinogenesis
oga05205  Proteoglycans in cancer
oga05208  Chemical carcinogenesis - reactive oxygen species
oga05210  Colorectal cancer
oga05211  Renal cell carcinoma
oga05212  Pancreatic cancer
oga05231  Choline metabolism in cancer
oga05415  Diabetic cardiomyopathy
oga05416  Viral myocarditis
oga05417  Lipid and atherosclerosis
oga05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100951369 (RAC1)
   04014 Ras signaling pathway
    100951369 (RAC1)
   04015 Rap1 signaling pathway
    100951369 (RAC1)
   04310 Wnt signaling pathway
    100951369 (RAC1)
   04370 VEGF signaling pathway
    100951369 (RAC1)
   04071 Sphingolipid signaling pathway
    100951369 (RAC1)
   04024 cAMP signaling pathway
    100951369 (RAC1)
   04151 PI3K-Akt signaling pathway
    100951369 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    100951369 (RAC1)
   04518 Integrin signaling
    100951369 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100951369 (RAC1)
   04148 Efferocytosis
    100951369 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100951369 (RAC1)
   04520 Adherens junction
    100951369 (RAC1)
   04530 Tight junction
    100951369 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100951369 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100951369 (RAC1)
   04620 Toll-like receptor signaling pathway
    100951369 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    100951369 (RAC1)
   04662 B cell receptor signaling pathway
    100951369 (RAC1)
   04664 Fc epsilon RI signaling pathway
    100951369 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    100951369 (RAC1)
   04670 Leukocyte transendothelial migration
    100951369 (RAC1)
   04062 Chemokine signaling pathway
    100951369 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    100951369 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100951369 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    100951369 (RAC1)
   04380 Osteoclast differentiation
    100951369 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100951369 (RAC1)
   05205 Proteoglycans in cancer
    100951369 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    100951369 (RAC1)
   05203 Viral carcinogenesis
    100951369 (RAC1)
   05231 Choline metabolism in cancer
    100951369 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100951369 (RAC1)
   05212 Pancreatic cancer
    100951369 (RAC1)
   05211 Renal cell carcinoma
    100951369 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100951369 (RAC1)
   05163 Human cytomegalovirus infection
    100951369 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100951369 (RAC1)
   05169 Epstein-Barr virus infection
    100951369 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100951369 (RAC1)
   05135 Yersinia infection
    100951369 (RAC1)
   05100 Bacterial invasion of epithelial cells
    100951369 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100951369 (RAC1)
   05020 Prion disease
    100951369 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    100951369 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100951369 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    100951369 (RAC1)
   05415 Diabetic cardiomyopathy
    100951369 (RAC1)
   05416 Viral myocarditis
    100951369 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100951369 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100951369 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oga04131]
    100951369 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oga04147]
    100951369 (RAC1)
   04031 GTP-binding proteins [BR:oga04031]
    100951369 (RAC1)
Membrane trafficking [BR:oga04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100951369 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    100951369 (RAC1)
  Macropinocytosis
   Ras GTPases
    100951369 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    100951369 (RAC1)
Exosome [BR:oga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100951369 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   100951369 (RAC1)
  Exosomal proteins of colorectal cancer cells
   100951369 (RAC1)
  Exosomal proteins of bladder cancer cells
   100951369 (RAC1)
GTP-binding proteins [BR:oga04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100951369 (RAC1)
SSDB
Motif
Pfam: Ras Roc CagD
Other DBs
NCBI-GeneID: 100951369
NCBI-ProteinID: XP_023372292
LinkDB
Position
Unknown
AA seq 127 aa
MVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTWYPEVRHHCPNTPIILVGTKLDLRDDKDT
IEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKR
KRKCLLL
NT seq 384 nt   +upstreamnt  +downstreamnt
atggtagatggaaaaccagtgaatctgggcttatgggatacagctggacaagaagattat
gacagattacgacctctatcctatccacaaacatggtatcctgaagtgcgacaccattgt
cccaacactcccatcatccttgtgggaactaaacttgatcttagggatgataaggacacg
attgagaaactgaaggagaagaagctgactcctatcacctatccccagggtttagccatg
gctaaagagattggtgctgtaaaatacctggagtgctctgctctcacacagcgaggcctc
aagacagtgtttgatgaagctatccgagcagttctctgcccaccaccggtcaagaagagg
aagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system