Otolemur garnettii (small-eared galago): 100952019 Help Entry 100952019         CDS       T07855                                  Name (RefSeq) histone H2A.J   KO K11251   histone H2A Organism oga  Otolemur garnettii (small-eared galago) Pathway oga03082   ATP-dependent chromatin remodeling oga04217   Necroptosis oga04613   Neutrophil extracellular trap formation oga05034   Alcoholism oga05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100952019  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100952019  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100952019  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     100952019   09165 Substance dependence    05034 Alcoholism     100952019  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oga03036]     100952019   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100952019 Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100952019 Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100952019 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  100952019 NCBI-ProteinID:  XP_012665517 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TE NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggaaagcagggcggcaaagtgcgggccaaggccaagtcccgctcctcc cgcgcgggcctgcagttcccagtgggccgcgtgcacagactgctgcgcaagggtaactac gccgaacgagtgggagccggggcgccggtctacctggcggcggtgttggagtacctgacc gcggagatcctggagttggctggcaacgccgcgcgtgacaacaagaagactaggataatt cctcgccacctgcagctcgccatccgcaacgacgaggagctaaacaagctgctggggaaa gtgaccatcgctcagggcggcgtcctgcccaacattcaggcggtgctgctacccaagaag acagag

DBGET integrated database retrieval system